CAZyme Information: MGYG000002773_01289

Basic Information

• Species: CAG-245 sp000435175
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-245; CAG-245 sp000435175
• CAZyme ID: MGYG000002773_01289
• CAZy Family: GT2
• CAZyme Description: D-alanine--poly(phosphoribitol) ligase subunit 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1437	MGYG000002773_14|CGC1	164446.52	5.3459

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002773	1604284	MAG	United States	North America

• Gene Location: Start: 29180; End: 33493 Strand: -

Full Sequence      

MELYDLTNPQKSIWLTEQFYKGSTINNLCGTVSISEAIDFTKLNEAINILVRDNDALRIH
LKQLEDGTIKQFFTEFSFKEYPLYDLSSSSDLKELESKLVAQKYQVLEGDLNNIVLFRFP
DSTGGLIIGLSHLVGDACTASLLASKVTTIYNSLKTGSDNTETPASYIDYILSEEQYLLS
QKFEKDKQYWEETFTSVPDVGIIPSLKTPLNENCEANRMLFTFSKQTVDNINEFCRNNRI
SIFNFLMGIYALYIGRVSNLTNFTLGTPVLNRTTFIEKNTPGMFISTVPLQFNLTSNSSF
VEFAQNIAKDTLSVFRHQKYPYQNILEHVRKTNPSQPNLYDILISYQNSKTNRNTSEIPY
RVNWIFNNNVADSMQIHMFDMNDEGSLNIAYDYRISKYSDIDILNIHNRISSMISQVLSN
PTISLYDIDIVTDEEKNRILNEFNDTYLEYDKNKTVIDCFEEQVSQNPDKIALVFKETSF
TYKELNEKSNILANYLIKTGTTAGDIIGLLINRSPEMIVGLIAILKAGAAYLPIDPAYPE
ERISYIIDNSECKKLLVNDSTMLLAHTNNIEHINISLNNSTIFDSEYSKENINLVINPES
LVYMIYTSGSTGKPKGVMIKHINLNNFLVAEKNIIDFNKNKVMVSVTTMCFDIFALEIWG
SLTSGMKLILASDEEQMSPSLLKRLCEKYSVNMIQTTPSRYLSLLSDETDLYFLDTLTDI
MVGGEAFPKILLEKLQKYSTAKIFNMYGPTETTVWSTIKDLTKSDFITIGKPIANTKCYI
LDKNKKLLPPNVCGELYIGGDGVSAGYWRRADLTAEKFITSPYSKNDVIYNTNDLAYFTN
DGEIVHLGRTDFQVKIRGYRIELQEIRNILLKFPNITDAVVTAYDNKFLVCYYTSSSKEL
VESDISAYLLKYLPNYMIPAHYIYLEKFPLTPNGKLDIKRLPKIENLKNPITLASTNTEK
EISNALSEILNTSDLDINTPFFDFGLDSLGIINAQTLLLRYNLVLSTQDFYKYTTIHELA
KKLDDTNSTKLEKKYQIPEQFMHSKEKLLLDFQKLNKSEDLLGNVLLTGANGFIGIHILH
ELIQNTNHKVFCLVREKENETSFERLRQAYMFYFDFDIAKLKDRLYVLSGSITDKNFGYN
IDDLESFLQNFSTIVHTAAKVSHYGKYDDFEDINIKGTKNIAEFAYRYHKRLIHISSISV
SGNYLVRQDNRNVDFSENNLYIGQHYTDNVYVYSKFKSETIVLSYMEKGLTAQILRIGIV
TGRFSDGVFQQKISHNAFYNRIKSLVMLGAVSANMLDNKIEFTPVDSCAKAIVTLAKNSI
CDNKVFNLYNQNLMRVESLVEIFRMSGFNIDILSKEEFNNLLHSIATTNSYSALDYIVND
FSVDADNQLSLNYNFSVNIKSEFTINYLHMLGFDWPAITDEYIYKIVNYMKKVGFIK

Enzyme Prediction     

No EC number prediction in MGYG000002773_01289.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05930	A_NRPS	5.24e-175	468	941	1	444	The adenylation domain of nonribosomal peptide synthetases (NRPS). The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester bond to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions.
cd17655	A_NRPS_Bac	6.62e-157	460	943	3	488	bacitracin synthetase and related proteins. This family of the adenylation (A) domain of nonribosomal peptide synthases (NRPS) includes bacitracin synthetases 1, 2, and 3 (BA1, also known as ATP-dependent cysteine adenylase or cysteine activase, BA2, also known as ATP-dependent lysine adenylase or lysine activase, and BA3, also known as ATP-dependent isoleucine adenylase or isoleucine activase) in Bacilli. Bacitracin is a mixture of related cyclic peptides used as a polypeptide antibiotic. This family also includes gramicidin synthetase 1 involved in synthesis of the cyclic peptide antibiotic gramicidin S via activation of phenylalanine. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions.
PRK12316	PRK12316	1.69e-152	6	1020	52	1081	peptide synthase; Provisional
PRK12467	PRK12467	3.73e-148	6	989	52	1062	peptide synthase; Provisional
cd12116	A_NRPS_Ta1_like	2.49e-146	468	941	1	470	The adenylation domain of nonribosomal peptide synthetases (NRPS), including salinosporamide A polyketide synthase. The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions. This family includes the myxovirescin (TA) antibiotic biosynthetic gene in Myxococcus xanthus; TA production plays a role in predation. It also includes the salinosporamide A polyketide synthase which is involved in the biosynthesis of salinosporamide A, a marine microbial metabolite whose chlorine atom is crucial for potent proteasome inhibition and anticancer activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFZ04852.1	8.98e-116	183	1023	317	1183
BAY30132.1	1.11e-109	6	989	2249	3259
BAY90071.1	6.29e-109	6	989	2238	3248
BAZ75991.1	1.50e-108	6	989	2247	3257
BAZ00088.1	1.50e-108	6	989	2247	3257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MFZ_A	1.99e-113	4	1020	786	1794	Crystalstructure of dimodular LgrA in a condensation state [Brevibacillus parabrevis],6MFZ_B Crystal structure of dimodular LgrA in a condensation state [Brevibacillus parabrevis]
2VSQ_A	3.43e-108	1	996	22	1011	Structureof surfactin A synthetase C (SrfA-C), a nonribosomal peptide synthetase termination module [Bacillus subtilis]
6MFY_A	2.14e-106	4	943	786	1714	Crystalstructure of a 5-domain construct of LgrA in the substrate donation state [Brevibacillus parabrevis],6MG0_A Crystal structure of a 5-domain construct of LgrA in the thiolation state [Brevibacillus parabrevis],6MG0_B Crystal structure of a 5-domain construct of LgrA in the thiolation state [Brevibacillus parabrevis]
4ZXH_A	1.01e-101	6	1030	19	1051	ChainA, ABBFA_003403 [Acinetobacter baumannii AB307-0294],4ZXI_A Chain A, Tyrocidine synthetase 3 [Acinetobacter baumannii AB307-0294]
6P1J_A	5.35e-99	4	941	6	964	Thestructure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module [Eleftheria terrae],6P1J_B The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module [Eleftheria terrae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27206	1.97e-149	4	1028	6	1047	Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAA PE=1 SV=4
Q70LM4	1.59e-146	6	1437	3641	5078	Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis OX=54914 GN=lgrD PE=1 SV=1
P0C064	1.93e-138	2	1028	3140	4165	Gramicidin S synthase 2 OS=Brevibacillus brevis OX=1393 GN=grsB PE=1 SV=2
P0C063	1.13e-137	2	1028	3141	4166	Gramicidin S synthase 2 OS=Aneurinibacillus migulanus OX=47500 GN=grsB PE=3 SV=2
O30409	2.42e-131	4	1020	5210	6230	Tyrocidine synthase 3 OS=Brevibacillus parabrevis OX=54914 GN=tycC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000090	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002773_01289.