CAZyme Information: MGYG000002762_01578

Basic Information

• Species: CAG-485 sp900554845
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900554845
• CAZyme ID: MGYG000002762_01578
• CAZy Family: GH5
• CAZyme Description: Endoglucanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000002762_78|CGC1	37572.62	5.2245

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002762	3275168	MAG	Netherlands	Europe

• Gene Location: Start: 10194; End: 11204 Strand: +

Full Sequence      

MRKLLYAVMAIVALGSIATACSNAKKATDEVNDKDSTFVTPLHVEGTYLLNAKGDTIVLN
GPSLGWHSNWGRFYNDSTVMAFKQKWNANVVRAAIGAHTSWDVVNCYDADSTTAMNRLYK
VIDAAIANDMYVICDWHSHENTLENAKKFFTAVTEKYGDAPNILYEIWNEPLEIEWQEVK
DYANAIIPLIRNKAPNSVIIVGSPKWDQDVDIASESPLEQKNLLYSLHFYAATHKDWNME
KAEKAIANGLPIIISECGGMEANGDGPVDQESMAKWVDFADRHKISMLMWAIADKNESCS
MVTPDASDNAMNWKDAQIKPWGKTAMQIIKNRNATK

Enzyme Prediction     

No EC number prediction in MGYG000002762_01578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	53	287	4.3e-87	0.9831223628691983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.44e-53	50	296	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.38e-04	1	232	2	272	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP72662.1	1.13e-162	1	334	1	334
QCD38972.1	1.13e-162	1	334	1	334
QRQ63760.1	2.18e-99	1	333	1	327
VTR51732.1	1.28e-98	42	333	41	328
AND74761.1	3.94e-97	17	333	16	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TVN_A	4.84e-69	39	322	2	292	Cellulasecel5G from Pseudoalteromonas haloplanktis, A family GH 5-2 enzyme [Pseudoalteromonas haloplanktis],1TVN_B Cellulase cel5G from Pseudoalteromonas haloplanktis, A family GH 5-2 enzyme [Pseudoalteromonas haloplanktis],1TVP_A Endoglucanase cel5G from Pseudoalteromonas haloplanktis in complex with cellobiose [Pseudoalteromonas haloplanktis],1TVP_B Endoglucanase cel5G from Pseudoalteromonas haloplanktis in complex with cellobiose [Pseudoalteromonas haloplanktis]
1EGZ_A	1.29e-68	39	321	2	287	ChainA, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_B Chain B, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_C Chain C, ENDOGLUCANASE Z [Dickeya chrysanthemi]
5IHS_A	3.72e-67	42	333	35	324	Structureof CHU_2103 from Cytophaga hutchinsonii [Cytophaga hutchinsonii ATCC 33406]
1A3H_A	2.20e-56	42	330	9	298	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]
1H11_A	2.40e-56	42	330	12	301	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07103	3.08e-66	39	321	45	330	Endoglucanase Z OS=Dickeya dadantii (strain 3937) OX=198628 GN=celZ PE=1 SV=2
P15704	6.42e-55	36	335	41	341	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
O85465	1.63e-54	42	330	38	327	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P06565	3.04e-53	42	335	38	332	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1
P10475	3.00e-51	42	336	42	337	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000059	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002762_01578.