CAZyme Information: MGYG000002762_00833

Basic Information

• Species: CAG-485 sp900554845
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900554845
• CAZyme ID: MGYG000002762_00833
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422	MGYG000002762_29|CGC1	46256	8.3366

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002762	3275168	MAG	Netherlands	Europe

• Gene Location: Start: 13469; End: 14737 Strand: +

Full Sequence      

MKVVIINKSDSTGGAAVVSYRLMVALMDAGVDARMLVAEKRTDSSCVDRAASKTALRGEF
LRERLGIYLQNGMDRGTLFKIDNGADGVAVWKHPWVKEADVICLNWINQGFVSLDGVRRL
LNLGKPVVWTMHDMWNMTGICHHAGECGNWRHNCGECPLLGDKARQNDLSARTWVHKEDV
YLNSKRKIQFVAVSNWLADKARMSGILGNENVTVIPNAFRFNDGDTGFIDGFRGGKCRIL
FGAARLDDPVKGLPVLVRATEILAAKHRNVANDCELVTFGNVKNPESIAGFGIGHRHMGV
LAGEAVEDLYRGGDIVVSSSLYETLPGTLVEGQAWGCVPVATDSGGQRDIVEHKQTGYLV
PCGSLEKTAEGLAEGIVWTYNELKKNGAALRHAMLESARGKFGSRQVAERYIELFRRLGV
KS

Enzyme Prediction     

No EC number prediction in MGYG000002762_00833.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	238	373	2.1e-18	0.85

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03825	GT4_WcaC-like	7.70e-87	1	418	1	364	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.
cd03801	GT4_PimA-like	9.19e-30	2	416	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	9.97e-25	92	418	77	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03823	GT4_ExpE7-like	3.34e-23	10	417	12	357	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
cd03798	GT4_WlbH-like	7.24e-19	3	418	1	376	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36841.1	4.17e-120	1	418	1	413
QCP72361.1	4.25e-96	2	415	19	427
QCD38673.1	4.25e-96	2	415	19	427
QCD41807.1	4.55e-95	2	418	23	434
QDO68538.1	2.36e-90	1	418	1	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BFW_A	2.15e-07	245	385	44	187	Structureof the C domain of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
6N1X_A	2.92e-07	304	411	265	367	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]
6D9T_A	3.10e-07	304	411	281	383	BshAfrom Staphylococcus aureus complexed with UDP [Staphylococcus aureus]
3L01_A	3.29e-07	245	415	259	427	ChainA, GlgA glycogen synthase [Pyrococcus abyssi],3L01_B Chain B, GlgA glycogen synthase [Pyrococcus abyssi]
3FRO_A	3.35e-07	245	415	259	427	Crystalstructure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_B Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_C Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1R8N8	1.73e-06	9	360	16	347	D-inositol 3-phosphate glycosyltransferase OS=Paenarthrobacter aurescens (strain TC1) OX=290340 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002762_00833.