CAZyme Information: MGYG000002758_00435

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381
• CAZyme ID: MGYG000002758_00435
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
733		85171.44	4.9369

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002758	2266069	MAG	Netherlands	Europe

• Gene Location: Start: 941; End: 3142 Strand: -

Full Sequence      

MEFQKGYYIRYDNSFKIETGGSEPPAKNPSLMLRKTFTVKEKPKRAEIIVCPLGIGYGFI
NAERITKDLFTAPYGDYRKTLWCLRYDVTDLIKEGENVIAFILGNGFYNEDMKNEWNGEL
ALWRDAPKLICELYFDGEPFVWSDESWRVCDDTPYISNRLRCGAVYDARKYDKNWYKLAF
DDSSWKFAQKDEKPPAGKFRLCECEGIREFEKLSPVSVKKTGDKKYLLDFGQNMSGYLKI
KVCQPSGEKIVFRYAEEADENGSLIYSDMMQRFFNCDFQTETFICSGESEEWSNLFCYYG
FRYVEADGLDMSLNPEIYAVFVHQNVERRSEFSCSNEFLNKLFNCGIVSTYSNLFYMPTD
CPTREKYGWMNDAQSSAEQILTDFKAERVLGKWNRDICDAMNEKGELPGIVPTHGWGYHW
GNGPVSDGSLFEQVYRIYLHSGEKKYLTGNLKYFRKYLNMLKEKENEEGFIEYGLHDWAN
PDNNEVLTPTELINAVYRVKFANIAALAARLGGEDDTEFTQEAERQKELIINKYITEDGK
CTVSEQTAIAMILYHDIYESPQMKLQLKKCVEDKQFHHSCGMVGIRHLYQALNKCGLQEY
AYKIVTAQGYPSYSLWLENGATTLWELWDCTESKNHHMYSDVLSWMIKTIGGISPDDNAA
TFEQIEVNPYYFKELSWAKASYDSPMGIVRCEWKREEGKIILKIEAPNDRCVQYRGVYLK
KGENIFVMDENNM

Enzyme Prediction     

No EC number prediction in MGYG000002758_00435.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	218	708	3.2e-112	0.9821428571428571
CBM67	22	191	1.5e-23	0.9090909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.23e-62	327	650	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.99e-35	42	211	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.48e-23	219	323	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.50e-10	652	707	1	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94103.1	1.35e-135	11	707	124	831
AHF16194.1	6.40e-129	32	707	174	852
QGA23306.1	6.46e-119	32	707	163	853
QUT54420.1	3.20e-118	29	709	139	835
QRO16731.1	6.29e-118	29	709	139	835

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.72e-94	32	707	178	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.18e-67	21	707	293	985	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.80e-63	22	693	123	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.49e-78	16	707	167	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	5.86e-67	21	707	293	985	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	3.65e-63	33	731	177	892	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	3.54e-55	33	707	173	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002758_00435.