CAZyme Information: MGYG000002738_02434

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia
• CAZyme ID: MGYG000002738_02434
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247		28064.69	5.3713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002738	3492433	MAG	Netherlands	Europe

• Gene Location: Start: 70; End: 813 Strand: +

Full Sequence      

MDYNIEPGIGTELNADSFGDGLLGHNRAYLEWLDRIFEKYPGLIIENCSSGGLRMDYAML
SRYSIQSTSDQEDYVRYATIAANSPSAVTPEQSAIWSYPLTDGNNEEVIYNMVNAILLRI
HQSGHLVNLNQERMGYVKEALDYYKSIRKDIKNALPYWPLGVSEYKDPWVSLGLRAEGVD
YLAVWRRNSQSGVASIPVKHLQGKKVEVKCGYPKKAPCSWHWNQEAGELTVELPERISAR
VFEIHEI

Enzyme Prediction     

No EC number prediction in MGYG000002738_02434.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.93e-32	2	145	151	298	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	6.02e-06	33	80	223	270	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	0.009	23	75	449	510	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE95776.1	3.41e-141	1	244	457	700
QIB55801.1	9.66e-141	1	244	457	700
QMW76333.1	9.66e-141	1	244	457	700
ADL52223.1	3.02e-122	1	246	457	702
AOZ93807.1	2.63e-113	1	246	452	697

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002738_02434.