CAZyme Information: MGYG000002738_02291

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia
• CAZyme ID: MGYG000002738_02291
• CAZy Family: GH94
• CAZyme Description: 1,2-beta-oligoglucan phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1095		124671.7	5.0891

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002738	3492433	MAG	Netherlands	Europe

• Gene Location: Start: 14129; End: 17416 Strand: -

Full Sequence      

MKKINHFLTIQQKNTTYSFLPTGDVFTFLHKNFLINQFRGNVLDGSVNNIYLRIYKENTP
PEIYPLLGVQSKSQIFASQERLLYKGSADTIHYQVEFRPVNNIWFWNITLQGSGMVDLVY
GQDLGIGEEGGIYTNELYISQYLGHSVFEGKNGYVVCSRQNMPCAGCFPYVQQGTIGIKT
EHFSTDGLQFFGLSYRENNMAEKLSGCLEDKNLQYEFAYTALQTEKFELEGEKHLAFYGI
FQENHPEAVAEIEFESELQAAYESLSQNVATPKNVETLHKKEEFGDVYSSPSFTEEELHQ
LFPVRNLEEVSDNHLYSFFTPEHSHVVTKEKELVCERPHGTIIITPPDTKHVNSELIAST
QYMNGVFNSHVVIGNTDMHKLLSTPRGFLNLLKNSGQRLYVRMGGQYRLLTLPGLFEMGM
NYSRWYYKLPDDILIVTAFTAASAPDITLQVNSTSGKSYDFIITNQLSAGPNEYAKDIHC
TSITDGLRFFVETPAYPGLHYDLILPKTSFQVSDDRIFFQENLPEDETFLTLSLTNETDF
SLIIHGALDEAEKGIRTNYSFQEEKEECLKYYSNLTSHFQLNARTGNEKTDILNETIWWY
THNAMIHFSMPHGLEQPGGAAWGTRDICQGPFEFFLTTQHYDLLRSILLNIFSHQNYDTK
EWPQWFMFDRYSMNAGECHGDVIFWPLKCVGDYINASGDVDILKEILPYDEAPEKKESLL
EHIKRALSNIKETRFIKNTGLITYAGGDWDDTLQPANEELKKSLVSAWTEALAYQTCCTL
SSAVTNIDSELSEELISMSQKIKETFLNVLIKDGVIAGFLENSEETNYLLHPSDKKTGIH
YRLLPMTRSIIAELVDSQQAAANTAAIEERLKCPDGVRLMDKPASYDGGISHLFKRAEQA
ANVGREISLQYTHAHIRYIEAMAKLGKANEAWNSLFIINPVLIQHSVPNARIRQSNMYFS
SSEGAYSTRYDYAENFHLLKTGKIDVKGGWRLYSSGPGIYLRQLIANVLGIRFDKKGLIL
DPVLPVELDGLTFSYDCYGRTFYFQYCISGNTDIYAEDEKGNISVEQLSNPYRRGGLLIP
KEVLENCSDTIKIYI

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	98	1047	1.2e-160	0.9324324324324325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	1.86e-171	19	1076	22	1044	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	1.57e-12	685	940	130	369	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ96874.1	0.0	1	1095	2	1100
BCN31622.1	0.0	1	1094	1	1095
AUS95384.1	0.0	8	1095	10	1115
BCJ99239.1	0.0	1	1095	1	1113
AIQ20111.1	0.0	8	1095	2	1105

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H3Z_A	0.0	1	1083	4	1097	CrystalStructure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans [Lachnoclostridium phytofermentans ISDg],5H3Z_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans [Lachnoclostridium phytofermentans ISDg],5H40_A Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose [Lachnoclostridium phytofermentans ISDg],5H40_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose [Lachnoclostridium phytofermentans ISDg]
5H41_A	0.0	1	1083	4	1097	CrystalStructure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose, isofagomine, sulfate ion [Lachnoclostridium phytofermentans ISDg],5H41_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose, isofagomine, sulfate ion [Lachnoclostridium phytofermentans ISDg],5H42_A Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with alpha-d-glucose-1-phosphate [Lachnoclostridium phytofermentans ISDg],5H42_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with alpha-d-glucose-1-phosphate [Lachnoclostridium phytofermentans ISDg]
4ZLE_A	1.02e-10	679	1046	403	746	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]
3QDE_A	1.62e-07	566	753	302	485	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
2CQS_A	1.11e-06	566	753	329	512	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q92AT0	2.45e-257	10	1092	7	1079	1,2-beta-oligoglucan phosphorylase OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=lin1839 PE=1 SV=1
P20471	1.35e-11	599	1030	2368	2789	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002738_02291.