CAZyme Information: MGYG000002725_01969

Basic Information

• Species: CAG-485 sp900554345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900554345
• CAZyme ID: MGYG000002725_01969
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557		62337.72	9.6275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002725	3333010	MAG	Canada	North America

• Gene Location: Start: 6355; End: 8028 Strand: -

Full Sequence      

MIDTRIEPEAGRIRYFWLVAVCVIAFFVNAGVLQSDLMESRNLVTAQEMTRYGNWLTPTM
NGTLRLEKPPLPTWVAAAIELLRPDSLPAQRAAAGVMGALWTLFLYLTVRAVTRRDHAAV
VSCLIFLTCYSVVLMGRTATWDIYCHAWMQGAVWLLFSLYYPRHAIGKGRRIWEFTACGV
MMGLSFLSKGPVAFFALLLPFLIACPFYGRPRRSPGNGRGLAVMIAAMVAVSAWWYVYIY
LVHPEMASAVLHKETGAWVNHNVRAWWYYWRYSAETGVWALITTGALLAPVLSRKVRRDR
SLVFAVVWMAASVILLSLMPEKKMRYLLPAMAPCAMSAGLLLCWIESHRKECRWGRVLFR
VNAWLIAAATAVLAGGALYMWLGMGKADAWVAVTGCALLLGVAAWMGICAVKMRVTGFVD
AVAVLFIAAECLLMSQVTHFFVNPEFHSLKEVRGDARLEGVELYSTDKGVIRMELVMAAG
RRILPADFSDARGMLRLMPCAVVTHGPVREALPAELLQQTDTLRIGVYDDNRHPRSDRHY
NQGLISYVTILRAKSQE

Enzyme Prediction     

No EC number prediction in MGYG000002725_01969.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	11	447	8.7e-62	0.8018518518518518

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.10e-25	7	436	2	425	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.28e-16	46	407	40	394	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	5.85e-08	68	236	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	3.50e-07	48	243	41	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT91247.1	1.57e-20	39	365	32	349
AUZ46381.1	2.78e-20	39	381	32	366
AZF42716.1	6.58e-20	39	365	32	349
AZF21623.1	6.58e-20	39	365	32	349
AZE94653.1	6.58e-20	39	365	32	349

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FRR0	8.18e-15	20	373	9	364	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
Q3KCC9	1.51e-14	39	348	50	357	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
Q4K884	2.73e-14	39	373	65	395	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
Q9HY61	3.37e-14	39	339	32	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arnT PE=3 SV=1
B7VBN0	1.38e-13	39	339	32	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999987	0.000036	0.000001	0.000000	0.000000	0.000013

TMHMM  Annotations     

start	end
13	35
93	112
119	141
191	208
220	242
267	289
302	321
326	345
357	379
389	411
418	440