CAZyme Information: MGYG000002721_01131

Basic Information

• Species: CAG-873 sp009775195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp009775195
• CAZyme ID: MGYG000002721_01131
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801	MGYG000002721_8|CGC2	91539.12	5.6993

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002721	3174810	MAG	Canada	North America

• Gene Location: Start: 45547; End: 47952 Strand: -

Full Sequence      

MKNIFTILFFIVCAAVVSAGESKVKPVNGDKISLFSLKDVRLGDSEFRHIMELNHDYYLS
LEPDRLLAWFRREAGLTPKAKPYPFWESEYMNGHGPLPGHIMGFYLSGISMMYDSTGDPE
IIRRLEYILDEFELCQEAAGDGYLLPTICGREIFENVVAGNFKTSNPFIETPYDKCWEPV
YVMNKIMLGLYNVYMRCGLTKARDILTRMSDWFGYEVVDKLSHDDLQKLLVCEHGSINES
FVNVYEITGEKRYLAWAQRLNDEDMWVPMSQGRDILEGWHANTQIPKFTGFESVYRFDGN
KDFTSAARFFWDTVTQKHTWVMGGNSTGEHFFAPEEFERRIELNGGPESCNSVNMLRLTE
ILYRDYAEVEKVDYYEKVLFNHILANYDPDQGMCVYYTSMRPGNYKVYGTKYDSFWCCTG
TGFEQTSKFAQMIYAHTDRDLYVNMFIPSTVDWHERGVKVTQSTRFPDEGSTELTIESAG
DFGLKIRCPFWTDTNTLRVSVNGKSKNMKAGPDGYITINRMWKSGDKVAVELPMHLEVVP
LSGSDKYLAVRYGPIVLGSPVKDETMTKDDFRSARSTVASKDFNVLDVPVFIGKTNKILP
QIRRKGASPLSFVCPKGRSASEEIELIPFYRIHWSRYAVYFRHYDTKEKYLDDKASQGKI
GEDESALDARTIDRVIIADSCSEALHKMEAVNSTNGANWRDAVRGGYFMYQMEVRPETPQ
AVCLQMLGSDGGNRVFDVMIDGKKIETIDISVPNPETKGLYRRYIRIPEELTADKNYITV
KLQAKNGSTAGGIFDIRTIAL

Enzyme Prediction     

No EC number prediction in MGYG000002721_01131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	39	557	3.1e-182	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.35e-177	39	557	1	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	6.02e-100	37	571	9	509	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	4.16e-11	587	641	28	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT86295.1	0.0	1	800	1	801
QJR53578.1	0.0	1	800	1	801
ALA72773.1	0.0	1	800	1	801
QJR78609.1	0.0	1	800	1	801
QJR61625.1	0.0	1	800	1	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.67e-151	25	799	18	801	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.12e-144	25	799	18	801	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	1.95e-21	181	630	143	609	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WRE_A	2.84e-12	145	630	97	642	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	2.87e-12	145	630	97	642	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.55e-11	145	630	97	642	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000254	0.999090	0.000185	0.000158	0.000151	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002721_01131.