CAZyme Information: MGYG000002711_02403

Basic Information

• Species: UMGS856 sp900546265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS856; UMGS856 sp900546265
• CAZyme ID: MGYG000002711_02403
• CAZy Family: GH129
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629		71148.18	5.3216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002711	3636319	MAG	Canada	North America

• Gene Location: Start: 41096; End: 42985 Strand: +

Full Sequence      

MDTPYYLQAGETFFAELDPRRCILRVTHRDVVYAFSSERPPFLEAEVDGAVQTIPFDMAR
SVLIREYAEETGGCLRARYADFYCGGTKLPLCVETVYRLRGDEGSLECELEITGDEAGAV
RRVCFPQPLDFDCEDGEAYTVLPMMQGTLIPAKWKNTVKTYSDGRYFESDGYMPWWGQAY
GGGACQCVCETPWDGGYALQHEPGGETAVCSAWYPSLGRMAYRRKCRFYFFRGGDYNVMC
LNYRRIVERRGELLTLREKIARTPSLAARIGKPVVHDFLFVSVDKLSPMYRRRLPQMNEY
FYSFEYRWKQIEALLEKGAAGFTVHLDGCGNRGYDNGHPDLFPINEAIGGEEGMRRFAAL
CREHGLPFDIHDQYRDFYFNAPSFRQEQAVFDRQGNLPVLSLWQGGRQSLLCATQASDYL
ERNLKRFQDSGIAFDGIHLGSFSGGAVDECFNPLHPMSKRECIEARRAAFALARSHGLAV
GSDEPMDCFLPWLDTVSHAPYSLSPSLWNGIGNGIPVPLFNLVYHDAVLVHWNSFQASLG
SWGIPNNDRYSTHAALNANPAYLSIDAGEEEIAECTALCELSRSLAFERMIRHEFLSGNF
RRQRATYSDGTAIEVDFDADTYRVYPGKS

Enzyme Prediction     

No EC number prediction in MGYG000002711_02403.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH129	90	624	3.1e-104	0.8592233009708737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14244	GH_101_like	2.54e-20	325	464	40	189	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
cd11336	AmyAc_MTSase	0.003	333	366	46	77	Alpha amylase catalytic domain found in maltooligosyl trehalose synthase (MTSase). Maltooligosyl trehalose synthase (MTSase) domain. MTSase and maltooligosyl trehalose trehalohydrolase (MTHase) work together to produce trehalose. MTSase is responsible for converting the alpha-1,4-glucosidic linkage to an alpha,alpha-1,1-glucosidic linkage at the reducing end of the maltooligosaccharide through an intramolecular transglucosylation reaction, while MTHase hydrolyzes the penultimate alpha-1,4 linkage of the reducing end, resulting in the release of trehalose. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
PRK14511	PRK14511	0.003	333	366	52	83	malto-oligosyltrehalose synthase.
pfam12905	Glyco_hydro_101	0.007	324	387	61	125	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH27706.1	4.28e-148	41	624	41	621
QUH27660.1	1.41e-147	24	624	14	626
QNK55038.1	3.66e-125	75	624	77	624
QTH41330.1	2.63e-124	24	624	28	624
QJD87097.1	3.90e-120	54	624	58	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WZN_A	1.54e-114	56	624	46	628	Alpha-N-acetylgalactosaminidaseNagBb from Bifidobacterium bifidum - GalNAc complex [Bifidobacterium bifidum],5WZN_B Alpha-N-acetylgalactosaminidase NagBb from Bifidobacterium bifidum - GalNAc complex [Bifidobacterium bifidum],5WZP_A Alpha-N-acetylgalactosaminidase NagBb from Bifidobacterium bifidum - ligand free [Bifidobacterium bifidum],5WZP_B Alpha-N-acetylgalactosaminidase NagBb from Bifidobacterium bifidum - ligand free [Bifidobacterium bifidum],5WZR_A Alpha-N-acetylgalactosaminidase NagBb from Bifidobacterium bifidum - Gal-NHAc-DNJ complex [Bifidobacterium bifidum],5WZR_B Alpha-N-acetylgalactosaminidase NagBb from Bifidobacterium bifidum - Gal-NHAc-DNJ complex [Bifidobacterium bifidum]
5WZQ_A	6.57e-109	56	624	46	628	Alpha-N-acetylgalactosaminidaseNagBb from Bifidobacterium bifidum - quadruple mutant [Bifidobacterium bifidum],5WZQ_B Alpha-N-acetylgalactosaminidase NagBb from Bifidobacterium bifidum - quadruple mutant [Bifidobacterium bifidum]
5OPQ_A	6.27e-16	49	629	84	666	A3,6-anhydro-D-galactosidase produced by Zobellia galactanivorans. This is an exo-lytic enzyme that hydrolyzes terminal 3,6-anhydro-D-galactose from the non-reducing end of carrageenan oligosaccharides. [Zobellia galactanivorans],5OPQ_B A 3,6-anhydro-D-galactosidase produced by Zobellia galactanivorans. This is an exo-lytic enzyme that hydrolyzes terminal 3,6-anhydro-D-galactose from the non-reducing end of carrageenan oligosaccharides. [Zobellia galactanivorans],5OPQ_C A 3,6-anhydro-D-galactosidase produced by Zobellia galactanivorans. This is an exo-lytic enzyme that hydrolyzes terminal 3,6-anhydro-D-galactose from the non-reducing end of carrageenan oligosaccharides. [Zobellia galactanivorans],5OPQ_D A 3,6-anhydro-D-galactosidase produced by Zobellia galactanivorans. This is an exo-lytic enzyme that hydrolyzes terminal 3,6-anhydro-D-galactose from the non-reducing end of carrageenan oligosaccharides. [Zobellia galactanivorans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002711_02403.