CAZyme Information: MGYG000002696_02192

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae
• CAZyme ID: MGYG000002696_02192
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
199		22005	4.9468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002696	2395340	MAG	Canada	North America

• Gene Location: Start: 227; End: 826 Strand: -

Full Sequence      

MVWSFMQNARMYEALRDYGDRLDTVGIFTFEVDATGTLSETGTSISSMMTYINKWPHIHW
MLTVMNHGTASIFTALRNNTNGAKDKFLTELVRIMEKYPWCAGVDIDLERGGGYENREAA
NALFQAIYQTVKAYDSSKLVNICLPGMTGVQGSVGGENWCVYADLNPYCDTASIMSYGMA
WAGSAPGPVSPPELVRGHL

Enzyme Prediction     

No EC number prediction in MGYG000002696_02192.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	9.28e-16	8	199	12	199	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	4.99e-11	13	199	119	303	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	3.50e-04	27	191	30	199	Glyco_18 domain.
cd02871	GH18_chitinase_D-like	0.006	79	111	90	121	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB62530.1	6.71e-135	1	197	12	208
AXB69977.1	6.71e-135	1	197	12	208
AUV57934.1	6.71e-135	1	197	12	208
QNU66284.1	2.09e-123	1	197	11	207
QQY45022.1	4.15e-123	1	197	11	207

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002696_02192.