CAZyme Information: MGYG000002693_00195

Basic Information

• Species: Anaerobutyricum sp002161065
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerobutyricum; Anaerobutyricum sp002161065
• CAZyme ID: MGYG000002693_00195
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		39183.15	10.3694

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002693	2842397	MAG	Canada	North America

• Gene Location: Start: 9957; End: 11036 Strand: +

Full Sequence      

MQHVTKLKKLVIFLLAFVMITSSVGASAAVTYQKGSRTYSYSGSSYTVYYNSKQVSTKKK
TGVLIDGSIMIPYKACLVKRGPKMTAKYNKSSKKLVLSYNGTKVKLFVGKKKIKVNGTKK
KISVAPLFVKFNGKKTLMIPARAVFEEGFGFTYEYKKKKKAVYITEPETTTNSAPVEVPA
APQTGGMTAAAFAGMNTSQFIQTMGPIAQADYKKTGILASVTLAQAILESGWGKSELAQK
GNNLFGMKTVLSGNTWSGSVWDGYSSVTINTGEEYDGKHVTISAPFRKYSCVEQSVADHS
AYLLNARDGSSYRYAGLTSTNSYKKQLTIIKNGGYATSSTYVSQLTSLIERYGLNQYDQ

Enzyme Prediction     

No EC number prediction in MGYG000002693_00195.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	204	354	2.7e-31	0.9921875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	4.46e-48	196	359	42	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	1.10e-31	174	358	138	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	4.91e-24	205	306	1	84	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK08581	PRK08581	6.38e-24	196	358	319	472	amidase domain-containing protein.
PRK12713	flgJ	1.02e-21	182	349	166	323	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SOB71776.1	1.49e-113	1	358	1	359
QUF81465.1	5.92e-102	1	358	1	356
SOB71898.1	2.60e-62	41	359	48	344
QUF79300.1	8.85e-60	1	359	1	344
QQQ98955.1	1.88e-55	186	358	202	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	2.81e-18	190	358	21	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	7.27e-17	196	358	59	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	6.60e-15	195	351	1	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	9.12e-15	195	351	1	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.92e-12	200	356	4	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	6.76e-28	200	359	51	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P39046	4.91e-18	193	358	58	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q2G222	9.20e-16	196	358	319	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P37710	1.02e-15	176	358	158	333	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9I4P4	1.40e-14	196	352	238	388	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000347	0.998965	0.000183	0.000169	0.000160	0.000151

TMHMM  Annotations     

start	end
10	32