CAZyme Information: MGYG000002683_02004

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; RUG12999; RUG12999
• CAZyme ID: MGYG000002683_02004
• CAZy Family: GH37
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510	MGYG000002683_169|CGC1	58987.74	5.1079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002683	3225682	MAG	Canada	North America

• Gene Location: Start: 679; End: 2211 Strand: -

Full Sequence      

MNKNFGASNWKEYIPIPVFDEHPEYLEFYNKAWQLAFDHIKNIPGMPQNPYMDEAFCATQ
IWIWDTCFMSLFCKYAREVFPGVESLNNFYSVLYDGKHLPEIMPPDNEPGWTGAVPGKPF
EIKLHIADNPPLFAWTEYENALFCGDKEYIKNLLYERKVLQKHYDWIENLHESVKMDTWQ
NPTCLIAEKYGYKWEGGRSGMDNTPRGRLEEHALKARPNNPDMLWLDAICQQAMSAHIIA
KLYDIVGDENQKEKWNKKYEEKKQIINDLYWDDADKFYYDIDCNTHEFYKVMSIASYWTM
TSETATAERAKLLTEQISNPKTFGGFVPLVSLSRSDNDYVSSGKYWRGSVWLPTAYAALK
GLAAYGYFSEARTAASKLLEHMYRTYTDYTPHTIWECYNPEEYKPATTEELGDSIVRKDF
CGWSALGPISVYIEFVLGFHTVDAFEKTVKWAKPNGIKGKIGIKNLKFGNIVTDIEADGE
NCTVISNNAYTLEINGKNYKIEAGENKFTL

Enzyme Prediction     

No EC number prediction in MGYG000002683_02004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	236	424	5.7e-21	0.35845213849287166

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	3.21e-16	136	401	477	759	alpha-glucosidase; Provisional
pfam01204	Trehalase	2.63e-13	238	399	317	474	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	2.71e-10	129	426	156	487	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	5.87e-10	238	390	366	510	Neutral trehalase [Carbohydrate transport and metabolism].
COG3408	GDB1	4.64e-06	45	476	275	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44762.1	3.42e-182	1	510	85	595
QZT38129.1	9.53e-161	15	510	33	502
AOW82330.1	1.88e-151	9	508	40	512
QWP09187.1	3.20e-139	9	510	4	476
QWP15489.1	3.20e-139	9	510	4	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.19e-07	237	400	562	731	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.19e-07	237	400	562	731	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	1.27e-07	237	400	111	280	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	1.27e-07	237	400	111	280	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]
7Q6Z_B	1.27e-07	237	400	133	302	ChainB, Megabody 177 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	3.45e-26	9	454	2	408	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P42592	6.62e-07	237	400	585	754	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000091	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002683_02004.