CAZyme Information: MGYG000002683_01533

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; RUG12999; RUG12999
• CAZyme ID: MGYG000002683_01533
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
179		20605.57	5.7585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002683	3225682	MAG	Canada	North America

• Gene Location: Start: 9948; End: 10487 Strand: +

Full Sequence      

MLKLKKIIIILAAVVLIFAFSHGYVEKNYIYPLKYSEYVKKAAAEYDVDKYLVYSIIKAE
SSFNEYARSHADAKGLMQVTDETAKWAAEKMNMHEDFNIYNPEININIGTWYISKLLTDN
GGDLVLALASYNAGGGNVKKWLENSGKDELDIDKIEFEETKTYVAKTLKYYEKYKNLYD

Enzyme Prediction     

No EC number prediction in MGYG000002683_01533.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	50	175	2.2e-28	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.33e-65	32	173	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.06e-58	31	177	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.76e-38	52	172	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	8.29e-33	31	178	135	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	3.91e-31	39	147	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEY66639.1	5.52e-48	2	179	12	192
ACL76418.1	2.05e-45	7	179	19	192
APM38048.1	1.73e-43	4	178	1	179
AEE91749.1	1.77e-43	5	178	3	179
CCP26520.1	1.77e-43	5	178	3	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	4.42e-16	31	170	445	588	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	4.47e-16	31	170	474	617	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
5MPQ_A	1.10e-15	19	168	386	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O24_A	1.10e-15	19	168	400	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O1J_A	1.10e-15	19	168	390	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	2.81e-17	31	173	1418	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.81e-17	31	173	1418	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P44888	3.80e-16	32	170	425	568	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P0AGC3	8.38e-15	31	170	476	621	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	8.38e-15	31	170	476	621	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.460998	0.281825	0.255742	0.000342	0.000255	0.000842

TMHMM  Annotations     

start	end
7	25