CAZyme Information: MGYG000002674_01202

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000002674_01202
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281	MGYG000002674_96|CGC1	31935.63	5.8524

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002674	2150198	MAG	Canada	North America

• Gene Location: Start: 3218; End: 4063 Strand: -

Full Sequence      

MKRLLMLAAMVSLAAPLTAQSRLETVTIPSRLLGAEKTCMVYLPDGYDRDTVRHYPIVYL
LHGASDTYTAWTKKGNMRQITDEAIAAGLAVPMVIVMPDASGEGEHHTGEHMGYFDVEGW
PYEQFFFEEFMPEIERRYRIVADKQHRAIAGLSMGGGGTAVYALRHPELFGSACSMSGLL
DLFPGPRSYDNAFMRSVVENSPVALLRDMPDEKLEAVRTVRWWVDCGDDDILWLSNVTFY
TTMRLRNVPLQYRMRDGVHSWRYWQTVLPDALSFFSIEFGK

Enzyme Prediction     

No EC number prediction in MGYG000002674_01202.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	31	275	2.3e-57	0.973568281938326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	2.66e-36	41	281	39	314	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	5.21e-27	33	275	4	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	4.97e-26	8	275	46	295	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG4099	COG4099	6.91e-07	42	178	179	302	Predicted peptidase [General function prediction only].
COG4947	COG4947	4.15e-06	149	269	105	224	Esterase/lipase superfamily enzyme [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJW91289.1	3.02e-31	23	270	139	383
QEH42336.1	2.18e-30	19	268	39	267
AVM58192.1	6.59e-30	41	268	166	389
AMQ56447.1	7.50e-29	18	268	138	377
QEL15076.1	8.16e-29	22	281	132	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	1.92e-74	15	281	4	274	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	1.44e-30	30	270	139	379	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	1.22e-20	35	178	151	297	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZO_A	7.46e-20	22	265	116	332	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	7.54e-20	22	265	116	332	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	6.99e-19	40	272	448	665	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	1.78e-18	23	178	500	654	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	2.01e-14	30	189	58	208	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P31471	2.72e-12	19	179	139	305	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P9WM38	4.88e-10	41	178	192	319	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000337	0.998998	0.000197	0.000159	0.000150	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002674_01202.