CAZyme Information: MGYG000002674_00585

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000002674_00585
• CAZy Family: GH57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325		37178.31	5.2728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002674	2150198	MAG	Canada	North America

• Gene Location: Start: 16121; End: 17098 Strand: -

Full Sequence      

MKAFAPEVLDSFKELAATGCVEFLAETYSHSLASLASKEDFEEQVKLHVNLIKKEFGVKP
TAFRNTELIYSDEIGAMVAGMGFRTMLAEGAKHVLGWKSPNYVYANAIDQKLRLLLRNYK
LSDDIAFRFSNKSWDQWPLTAEKYVGWLASEDTPGEVINLFMDYETFGEHQTADTGIFEF
MRALPGMILSKKNELEFATVTETAKKHQPVSVLHCPHVMSWADEERDVTAWLGNELQNEA
FKKLYAQKEKVKALKSPDFDYVWSFMQTSDHFYYMATKWLSDGDVHSYFNPYDSAYDAFI
NYMNVLSDFIIELDKALAAKKAKKA

Enzyme Prediction     

No EC number prediction in MGYG000002674_00585.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH57	3	251	2.9e-57	0.6370757180156658

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10795	GH57N_MJA1_like	7.81e-145	1	234	78	306	N-terminal catalytic domain of a thermoactive alpha-amylase from Methanococcus jannaschii and similar proteins; glycoside hydrolase family 57 (GH57). The subfamily is represented by a thermostable alpha-amylase (MJA1, EC 3.2.1.1) encoded from the hyperthermophilic archaeon Methanococcus jannaschii locus, M J1611. MJA1 has a broad pH optimum 5.0-8.0. It exhibits extremely thermophilic alpha-amylase activity that catalyzes the hydrolysis of large sugar polymers with alpha-l,6 and alpha-l,4 linkages, and yields products including glucose polymers of 1-7 units. MJ1611 also encodes another alpha-amylase with catalytic features distinct from MJA1, which belongs to glycoside hydrolase family 13 (GH-13), and is not included here. This subfamily also includes many uncharacterized proteins found in bacteria and archaea.
COG1449	COG1449	6.63e-84	2	312	175	501	Alpha-amylase/alpha-mannosidase, GH57 family [Carbohydrate transport and metabolism].
pfam03065	Glyco_hydro_57	1.29e-62	4	213	86	290	Glycosyl hydrolase family 57. This family includes alpha-amylase (EC:3.2.1.1), 4--glucanotransferase (EC:2.4.1.-) and amylopullulanase enzymes.
cd01022	GH57N_like	3.05e-34	6	233	78	313	N-terminal catalytic domain of heat stable retaining glycoside hydrolase family 57. Glycoside hydrolase family 57(GH57) is a chiefly prokaryotic family with the majority of thermostable enzymes coming from extremophiles (many of these are archaeal hyperthermophiles), which exhibit the enzyme specificities of alpha-amylase (EC 3.2.1.1), 4-alpha-glucanotransferase (EC 2.4.1.25), amylopullulanase (EC 3.2.1.1/41), and alpha-galactosidase (EC 3.2.1.22). This family also includes many hypothetical proteins with uncharacterized activity and specificity. GH57s cleave alpha-glycosidic bonds by employing a retaining mechanism, which involves a glycosyl-enzyme intermediate, allowing transglycosylation.
cd10796	GH57N_APU	5.29e-12	7	233	64	313	N-terminal catalytic domain of thermoactive amylopullulanases; glycoside hydrolase family 57 (GH57). Pullulanases (EC 3.2.1.41) are capable of hydrolyzing the alpha-1,6 glucosidic bonds of pullulan, producing maltotriose. Amylopullulanases (APU, E.C 3.2.1.1/41) are type II pullulanases which can also degrade both the alpha-1,6 and alpha-1,4 glucosidic bonds of starch, producing oligosaccharides. This subfamily includes GH57 archaeal thermoactive APUs, which show both pullulanolytic and amylolytic activities. They have an acid pH optimum and the presence of Ca2+ might increase their activity, thermostability, and substrate affinity. Besides GH57 thermoactive APUs, all mesophilic and some thermoactive APUs belong to glycoside hydrolase family 13 with catalytic features distinct from GH57. This subfamily also includes many uncharacterized proteins found in bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63586.1	5.34e-223	2	324	81	403
BBL06689.1	3.46e-221	2	323	81	402
AFL77588.1	5.46e-218	2	323	81	402
BBL01286.1	7.40e-216	2	323	81	402
BBL12011.1	7.40e-216	2	323	81	402

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59006	1.12e-92	4	318	81	401	Putative alpha-amylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1611 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002674_00585.