CAZyme Information: MGYG000002673_00550

Basic Information

• Species: UBA9475 sp900549885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA9475; UBA9475 sp900549885
• CAZyme ID: MGYG000002673_00550
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823		94874.2	5.4007

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002673	2826346	MAG	Canada	North America

• Gene Location: Start: 124869; End: 127340 Strand: -

Full Sequence      

MITKQLHDGWRMRVAGDRQWFPAQVPGSVYQDLLNSGMIDDPYDRDNELAALAVMDQDFE
YELEFDTPAGMLEQEAVLLRFEGIDTVADLELNGMALGHVENMHRTWEFPVKDALREKEN
RLRVCLRSPTRYIRQANEKNPLLGTADAMEGFPHLRKAHCMFGWDWGPRLPDAGIWRAVS
LMAYSAARLDNVYITQEHGEDAVTLRFQVQAVRPGEASLLDLSAAQTAGLSCRAVVTGPG
GEQWEAGGQALFHSGIVIQTPRLWWPNGYGDQPLYRAAVELLSNGTVIDRWERRIGLRTM
TVCRDKDQWGEQFCHMVNGVKIFAMGADYIPEDCILARMTPERTRWLLEQARAAHHNCIR
VWGGGHYPADAFYDACDELGLVVWQDFMFACAVYDLTEDFEANIIAEAVDNIKRLRHHAS
LGLWCGNNEMEMFVELGVWVNKPSQKSDYVKMYEYLLPKLCRRYDPNTFYWPASPSSGGA
FDKPNDENRGDAHYWDVWHGNKPFTEYRKFYFRYVSEFGFQSFPSLKTCESFTRPEDRNI
FSYVMEKHQRNATANGKIMNYLEQTFLYPTDFDTVLYASQLLQAEAIRYGIEHFRRHRGR
CMGTIVWQLNDCWPVASWSSIDYYGRWKALHYYEKRCFAPILISCEEEGILTQDPNPNAQ
PYVVRKSIRLNVANETRRDVAVTVRWALRRADGRIKWEREQAVRVPALSAVWLDPEELPD
ADLYGDYVSYECFQDDAVLSQGTVIFCPHKQFHYQDPRLSVRVEGDEVVVSARAYAKAVE
VRNENEDLLLEDNYFDMNGGERRLKILGGTPNGLRVRSVYSIR

Enzyme Prediction     

No EC number prediction in MGYG000002673_00550.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	771	1.5e-105	0.7672872340425532

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.32e-98	6	803	15	806	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.57e-12	58	429	66	417	beta-D-glucuronidase; Provisional
pfam17786	Mannosidase_ig	8.31e-12	668	750	3	90	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	1.14e-09	187	298	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	3.47e-08	10	429	80	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF82182.1	0.0	1	823	1	816
QBE97789.1	0.0	1	823	15	837
QJU13790.1	0.0	1	823	1	823
QQQ93614.1	0.0	1	823	1	823
ASU28856.1	0.0	1	823	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	9.72e-157	1	801	3	826	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	9.99e-157	1	801	3	826	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	7.14e-156	1	801	1	824	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	7.34e-156	1	801	3	826	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	5.94e-154	6	807	11	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	4.44e-112	6	648	9	663	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q0CCA0	3.31e-111	2	648	5	661	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q4WAH4	3.46e-111	6	648	9	663	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	1.32e-110	6	648	9	663	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1D911	7.01e-110	6	648	9	663	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002673_00550.