CAZyme Information: MGYG000002668_01164

Basic Information

• Species: Prevotella sp900552965
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900552965
• CAZyme ID: MGYG000002668_01164
• CAZy Family: GH98
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1052		117989.11	6.9667

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002668	2820424	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 3659; End: 6817 Strand: +

Full Sequence      

MKNPKYLLLSLIVLLTASLASAQQRRPVDSQHPMWLVHVDVWNQADPQKIIDLIPDDIKP
FVVMNLSLSCAYDTELNIHQRPQNAIPTYKSWASVCQMNNMWFTLQPASGGHTHIHDNDL
ETFEYFFKKYPNFLGWNFAEQFWGFNEPGDLFSASDVDRIQLFAELIPMHHKYGGFLTVS
FCGNVWSHTLNPVGMMKRNAALLQACKDYPESILWLYKYTTSSCFYNNESVTFGPFVAGL
TRNYGVRYDNCGWNGATSDLVGENKCKYPNAAGIGTVMEQTCQNGGAVWDGPELIWTEDF
QNLSDGTVKDGTKTYKVRRWGTFPGFRNVWMDMWRKVIDGTMYIPTQQEVIDKTNVIIVN
DVKSGSDEDKYATWADLYDGLYKQNDPFNKGNGQWMNNYWYLKKTGRYGTIPMTPCLTSM
ATGIQTKVKKSQRSSVWPSLSTKTAKFNAAYPEVSTGDLFVSRYRNQLVTYTPYTYLNSK
TTASANVPLLYNTCQSMDLTWGKLSSAIVKEYADSICFYLNNFRSDTTKNVVDRIVINGV
TAEPKISWTKRAEATASVTPSWDAAKGVYTLTVSHLGPVDLKVECQGTATDRKTDYVGNT
ALPLPAQPEDFFGTLIIEAEDMDNCNVQSMEQFPYGGSYRWVRGHSGNGFVVMGRNSAGA
LRKVFRVKKGGEYRIAVRYNNTHKKDYVRIRINDETAQRKLFLMTGKNEWRKDTITATLN
AGENKFYLFNTASIDMMVDQVIFSPADEEIEKFDITIKSSEHGSPIASVESAQEGETVTL
TANPADGYDFKGWNIIHGKIDLKDNGDGTFSFTMPEDIVTLEPIYVDNTVIYKMDLTNVL
EGTFPEGWRAETSATSAQEYPNSYGSGPRTFVGFTGTYYKGTYWRGLAYNYGKQTNHKLH
LAPGNYRLSYAMAAWKGTPQFKAQILSSNGTTLKESQNFTASPNAGGNKSADLSSAKVRE
MDFTVTKEGDYIINFHTDGGEWGGEMLLLSCSIHKVPAATSIDSVIVGGDLETAGCEIYD
ESGRRIPSLKRGLNIIRRNGVEVKKVFIAGGK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH98	22	342	2.7e-86	0.9908256880733946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08306	Glyco_hydro_98M	6.63e-86	22	341	5	327	Glycosyl hydrolase family 98. This domain is the putative catalytic domain of glycosyl hydrolase family 98 proteins.
pfam18998	Flg_new_2	4.41e-06	755	829	3	74	Divergent InlB B-repeat domain. This family of domains are found in bacterial cell surface proteins. They are often found in tandem array. This domain is closely related to pfam09479.
cd04081	CBM35_galactosidase-like	9.02e-05	646	725	24	107	Carbohydrate Binding Module family 35 (CBM35); appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. This family includes carbohydrate binding module family 35 (CBM35); these are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. Examples of proteins which contain CBM35s belonging to this family includes the CBM35 of an exo-beta-1,3-galactanase from Phanerochaete chrysosporium 9 (Pc1,3Gal43A) which is appended to a GH43 domain, and the CBM35 domain of two bifunctional proteins with beta-L-arabinopyranosidase/alpha-D-galactopyranosidase activities from Fusarium oxysporum 12S, Foap1 and Foap2 (Fo/AP1 and Fo/AP2), that are appended to GH27 domains. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). Some CBM35s bind their ligands in a calcium-dependent manner. In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates, while family GH27 includes alpha-galactosidases, alpha-N-acetylgalactosaminidases, and isomaltodextranases.
cd02795	CBM6-CBM35-CBM36_like	0.004	617	743	2	124	Carbohydrate Binding Module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules. This alignment model also contains the C-terminal domains of bacterial insecticidal toxins, where they may be involved in determining insect specificity through carbohydrate binding functionality.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29515.1	0.0	9	1048	7	1034
AOZ99817.1	4.06e-160	2	781	10	780
AXY74108.1	8.82e-160	8	745	16	750
AJQ96076.1	3.47e-158	34	744	1	696
BAV06735.1	2.58e-157	21	746	31	749

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WMF_A	2.12e-09	52	583	64	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in its native form. [Streptococcus pneumoniae TIGR4]
2WMG_A	2.79e-09	204	583	198	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in complex with the LewisY pentasaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
2WMH_A	2.79e-09	52	583	64	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 in complex with the H- disaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001285	0.996231	0.001737	0.000257	0.000221	0.000207

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002668_01164.