CAZyme Information: MGYG000002662_01505

Basic Information

• Species: UBA3388 sp900546465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; P3; UBA3388; UBA3388 sp900546465
• CAZyme ID: MGYG000002662_01505
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		43031.39	9.3904

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002662	2000155	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 15023; End: 16147 Strand: -

Full Sequence      

MRYYIIAGEMSGDLHASFLMKELKERDMNAEFRFWGGDKMIAQASQECLVKHIKDLAFMG
FVEVVAHLKTVLGNISLCKKDIRSWKPDAVILVDYPGFNLRIAKFAHKAGLKVYYYVSPQ
VWAWKKRRIKTMKKVLDKLFVILPFEKSFYEKHNMEVEYAGNPLLDEIADYMKTQDKNSF
LQTNGLGKKPVIALLPGSRTQEIKKMLPIQLDLVEKYPEFDFVIAGVGTHSPQFYEQYIE
ERNVKLIYNRTYSLLNCAYAAVVTSGTATLEAALFNLPEVVCYKANALSFLIGKYLAKVR
FISLVNLILNAPVVVELLQKDWNEQCLEKEFRRISFDENYRIQMQYMFGKLRTILGNAGA
SANVAKYIIGDLER

Enzyme Prediction     

No EC number prediction in MGYG000002662_01505.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	354	2.7e-115	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.81e-115	1	369	2	372	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.98e-105	1	369	2	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.07e-79	4	325	2	329	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.81e-70	5	369	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.71e-62	1	368	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA00861.1	2.28e-139	1	373	1	370
AOW20458.1	8.05e-139	1	370	1	367
AIP99513.1	1.68e-138	1	369	1	365
AFL96694.1	1.68e-138	1	369	1	365
QYN51796.1	1.10e-137	1	374	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.12e-42	5	327	11	337	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.96e-42	5	327	11	337	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5X5J5	1.12e-70	2	372	6	379	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Paris) OX=297246 GN=lpxB1 PE=3 SV=1
B6J161	3.54e-70	5	368	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	4.98e-70	5	368	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J9H1	4.98e-70	5	368	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
Q5ZVR9	6.23e-70	2	372	6	379	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpxB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002662_01505.