CAZyme Information: MGYG000002656_01263

Basic Information

• Species: F23-B02 sp900772725
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; F23-B02; F23-B02 sp900772725
• CAZyme ID: MGYG000002656_01263
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580		65590.4	7.1901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002656	1621357	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 938; End: 2680 Strand: +

Full Sequence      

MRVTYFFTFLVLMLIALFLLACPSPRKAKLGAASETTFCRVDALALGAIMLVYAIAAFTG
LGDTGAAQSFHKFNSGESAVIDLGEVRTVDGAMLYSGLNTGSYYIEISDDGERWRDAGDF
EQNYVALFKWNDVEALSGVSARYIRLTAQGSVWLGELGIKCGGGLYGASADAPELFDEQE
YVPEYQHFTNSSYFDEIYHARTALENIEGIYPYEVSHPPLGKLIIAIGIQLFGMTPFGWR
FSGTLFGVLMLPVMYVFIKKLFGRSSIAACGTAIFAFDFMHFVQTRIATIDTYAVFFILL
MYLFMYLYITGGRLRHLALSGVFFGLGAASKWTCIYAGAGLAVIWLIYWLRHFELKAFLK
NCAFCLVFFVLVPAVIYYASYYPYGAAQGMSGIEMYFTADYANIVLDNQKFMFTYHSGVT
TEHPYSSRWWQWIINERPILYYLKHFDDGTRSSFGAFLNPVLCWGGFICMIICSVYLIKR
RDEASLFIIIGYLAQLLPWVFITRTTFEYHYFPASVFLVLALCRVFSLIRENVKGWRFNV
YGLTALSLAAFVMFYPALSGLRVNSQLATNLLKWLPNWPF

Enzyme Prediction     

No EC number prediction in MGYG000002656_01263.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	190	384	6.7e-55	0.9147982062780269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	9.22e-25	409	576	7	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	1.34e-16	190	382	46	265	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam13231	PMT_2	2.76e-16	216	377	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG4346	COG4346	5.37e-16	205	443	126	331	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	8.76e-15	190	383	19	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42918.1	1.00e-171	23	580	46	653
QQR07704.1	1.00e-171	23	580	46	653
QIA32159.1	3.21e-169	23	580	42	649
QBB67038.1	2.24e-155	40	580	74	752
ALP95330.1	4.46e-155	40	580	74	752

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	1.59e-25	175	578	72	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.59e-25	175	578	72	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	2.13e-24	167	578	57	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	2.96e-18	164	578	52	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.969484	0.004992	0.025297	0.000031	0.000017	0.000169

TMHMM  Annotations     

start	end
5	22
43	62
236	258
293	312
332	350
363	385
456	478
485	507
511	528
535	557