CAZyme Information: MGYG000002653_02083

Basic Information

• Species: Prevotella sp002251295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251295
• CAZyme ID: MGYG000002653_02083
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
998	MGYG000002653_44|CGC1	112781.55	7.3389

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002653	3045320	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 4527; End: 7523 Strand: +

Full Sequence      

MQIKRLLLMALSAVALQSTARDKIDLSPLAWDITLDPQAQWENDKLFTPPVTMASLPVNL
PTGGWQLLDHPQKTGVHLPATVEGEMWGWNGQTYGVTGNYVGVSWFRTQVDVPANWQGKR
IALQFDAVRFRAEIFVNRQLVGYDLVNSTPFEVDITPYAKVGQKNEVAVRITDPNGNFNW
KDSQCYAWGAYLTNPSHGFGGITGRVHLVATDNTFIRDMFVENTPVASTVKVHIAAEGVK
QATPLKLELRERGSNKVVWSRQEQMDGSEKTLTLSLPQAKLWSVEEPNLYELTAKLGNDE
LTQRFGFRWFEVRDVKGDRQFYLNGKRITLITAISWSFWPDNGITPSRELAYKQVRDAKQ
LGMNMLNFHRTIGNTDVLNAADELGLLYFEEPGGNQYPANKFDDGTDYTQFYFNYRNEKL
ARMIRRDRSHPSLVIYNLHNERGASPQAEDRRQMQMAHRLDPSRILTYNSCNGKNPEGLP
DDHFKLHLMPGDTTFHNIGWWDNHHAGGPGVYHDYIYKGKDDYLRFSDNKGEIVYWGEEG
AIGTPPRLQLIRDEILRSGRTNNWEAADYLAWYDAYDNFLRTRGFSKAFPCVDSLTRQMG
NVAYYYQGRVMENVHISNTVDAYAINGWEAMKLENHSGVVDNYRNLKGDAQLIARYNRPL
YLSVKLTHKVLAVGDTTTTDVYIVNRKDIHGPAMLQLTARDAQGKVLSQMKKRVKVSGGV
VYGENLMTGWKVRIPCAGYVSIEAQLQQHGRTVATGDDKIYAVAMNATGIDGVCAVADTT
GVLAAYLDAQGVKTVNYHRGRPQADLMIVGAFEPTQFGSGYSDILEWVYSGHTLVIVDNP
TRWADLLCDKEVMDYRGEKALGRSWYGGNFFCRSHPIFEGLPTDCVFNWEYQCFAAYNRR
RIGLRDMSSEVLVGCVSDHRKEVYSALSEIPAGRGRILITTLDIPACLKGTEAYTKKVDL
DGMNESMNTFNTQGMNKADAVGRQLLLNMLRYASQHKQ

Enzyme Prediction     

No EC number prediction in MGYG000002653_02083.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	63	683	1.6e-81	0.6861702127659575

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.66e-38	21	592	10	567	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.58e-28	99	468	62	447	beta-D-glucuronidase; Provisional
PRK10340	ebgA	4.32e-23	106	468	113	474	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	6.48e-14	37	183	20	139	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam00703	Glyco_hydro_2	1.92e-11	214	308	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII65142.1	0.0	24	991	29	1005
QJR62726.1	0.0	24	991	29	1005
QJR75369.1	0.0	24	991	29	1005
ALA73626.1	0.0	24	991	29	1005
QJR56769.1	0.0	24	991	29	1005

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	4.13e-28	58	441	37	405	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	7.25e-28	58	441	37	405	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3GM8_A	3.71e-26	102	509	66	466	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6SD0_A	1.68e-23	106	468	114	466	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	1.68e-23	106	468	113	465	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	9.18e-23	106	468	114	466	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P77989	1.81e-22	99	464	53	410	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	1.10e-21	104	464	105	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KM09	2.36e-21	59	472	69	460	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P26257	9.93e-20	104	464	56	411	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000336	0.998871	0.000230	0.000198	0.000172	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002653_02083.