CAZyme Information: MGYG000002650_02146

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452
• CAZyme ID: MGYG000002650_02146
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	MGYG000002650_247|CGC1	49267.51	5.2758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002650	3040804	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 1544; End: 2815 Strand: -

Full Sequence      

MFELLTENNISFPDGFLWGTGTAGHQIEGNNIHSQRWNEELADRERYPEVSGEACGSWER
FGRDAQMAAECGSQVYRFSVEWARIEPEEGQFNAAALNRYLELMRDLQKRGIRRMVTLHH
FTHSAWFEAKGGFGRRENTVCFLRYLEYLVPRIAELTDGWVVFNEFNGDLIPAENKANFL
YAQADAARLIRSYSKAPIGIAHAYTPFVPEEPDDEFDRMECERRDWAANRFFFHAIRTGE
VVIPEREAEQIDGLKDSCDFWGINYYTRHYVSARHPGAFLPRPACDRVKMIRSDFYLEEC
CPEYLLRGLLTLRDKPVWITENGCACNDDRLRILYLARHFSAVAEAIRRGVDVRGFLVWT
LMDNYEWGSYEPRFGLYSIDRTTFEAQPKPSASFFRETAERNGINAEMVLKYVPELKDFK
IYT

Enzyme Prediction     

No EC number prediction in MGYG000002650_02146.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	11	403	1.5e-94	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.67e-81	12	404	4	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	4.37e-75	10	403	3	452	Glycosyl hydrolase family 1.
PLN02849	PLN02849	8.93e-32	12	395	30	476	beta-glucosidase
PLN02814	PLN02814	2.59e-29	5	395	23	476	beta-glucosidase
PLN02998	PLN02998	2.08e-27	12	395	31	481	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43515.1	3.97e-140	1	421	1	419
ADW18818.1	2.17e-133	1	416	1	429
ADQ08048.1	1.95e-114	1	416	1	423
QCX34294.1	1.22e-111	1	416	1	421
QNM13665.1	3.93e-102	1	418	1	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VFF_A	5.07e-70	10	417	3	422	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
6IER_A	1.17e-66	9	408	29	436	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
6Z1H_A	1.22e-60	9	407	8	453	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
4R27_A	1.07e-58	12	403	7	413	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
4HZ6_A	2.05e-48	12	404	5	442	crystalstructure of BglB [uncultured bacterium],4HZ7_A Crystal structure of BglB with glucose [uncultured bacterium],4HZ8_A Crystal structure of BglB with natural substrate [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14288	2.79e-45	10	420	2	490	Beta-galactosidase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=bgaS PE=1 SV=2
P22505	2.47e-43	5	403	1	447	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1
Q08638	6.39e-43	12	404	6	444	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P38645	1.44e-42	9	404	35	469	Thermostable beta-glucosidase B OS=Thermobispora bispora OX=2006 GN=bglB PE=1 SV=1
P10482	1.45e-42	9	403	2	455	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002650_02146.