CAZyme Information: MGYG000002650_01744

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452
• CAZyme ID: MGYG000002650_01744
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
694		77491.16	6.0482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002650	3040804	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 4602; End: 6686 Strand: -

Full Sequence      

MADTEIDKLLRTLTVETFSRKDLDPWVRECRDIYSPGHRDAFIGNGLIGLRVPPEGEPSV
YPTFKAVKMAPGGTQMYGLWDENGNVPAFNFMGLRLTHGRMVFRRDSGAITGYAQKLDWR
NATVTTECDWHHWGGKVHIRIVTWLSRSRQNTGCVEMSLTSDYDTGFCIYDIVDGSFIPE
HSPVKYKLFASHVVPKVISSNFGGRHVAAATAVTVDGEPAPGEVELIPDGYQREIVVMLR
KGETHTVAKYASMVTDEYVSDPVNAAAMAVNSAMSNPAKFRAEHEAAWAKLWEHRIEVDH
PGVQMLANDALYHLYCNVDENGKGCVPGPAGLSGNAWSGHIFYDADTWSFPPAALMNPGM
ASNYVKYRVSTLPGARRNAAASGLDGALFPWEGGKSGDELVPGLIYSLQHHINSDVVQAA
WNYYLASGDEDFIRNEGAELILAVADFWVSRVVYNAEKDRYEILKVCCPDEIAHVQDNNA
FTNYGAKVTLLLAEKLVKKIGGTVNPKWREIAEKLWIPFDEKNQRIIEYEGYNGQTIKQA
DAILLIYPMEMPLSAEAKKNTCEYYRAKYEAQKIMMSSAIHGIIDAEIGDTESSWQMFLD
LLKHFRGDYLLVSESPVNETMSLLTGLGGMMQLLMMGWGGLRLHEAKLDAKPSLPAEIKS
LKILGVHYRGECYDLAADHFGYKLEKQQSRRKEF

Enzyme Prediction     

No EC number prediction in MGYG000002650_01744.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	310	645	5.1e-89	0.989247311827957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	5.79e-109	22	689	7	747	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	2.60e-67	328	648	21	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	3.63e-37	239	670	247	715	maltose phosphorylase; Provisional
pfam03636	Glyco_hydro_65N	1.21e-17	43	255	19	239	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT94471.1	2.80e-183	24	675	24	677
AVH60605.1	2.08e-93	24	681	24	706
QOV40874.1	2.17e-88	12	676	33	715
ATA70256.1	1.69e-81	24	673	20	669
AWW41663.1	1.79e-80	37	675	36	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	3.75e-78	24	666	22	667	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	1.54e-49	279	687	277	739	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	3.38e-42	43	655	35	703	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	8.21e-42	43	655	35	703	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
1H54_A	1.09e-27	284	655	297	703	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	6.96e-68	284	675	258	659	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
A0JMP0	7.88e-64	273	693	175	612	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Danio rerio OX=7955 GN=pgghg PE=2 SV=1
F1NZI4	4.63e-58	282	670	239	641	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3
Q8BP56	1.29e-50	284	685	230	645	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Mus musculus OX=10090 GN=Pgghg PE=1 SV=1
Q8RBL8	1.06e-49	283	690	296	757	Kojibiose phosphorylase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) OX=273068 GN=kojP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002650_01744.