CAZyme Information: MGYG000002650_01333

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452
• CAZyme ID: MGYG000002650_01333
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		38402.33	6.0946

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002650	3040804	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 5283; End: 6314 Strand: -

Full Sequence      

MAIQKFTVSNDPSIYEAWPDVVLANPEKMVCVFSECTHHGDRSYTRIMLTESTDRGRTWT
RKRPLTEGTAGKDYFYNCARINRLPDGRLAVTVDRIVHGSDEQVARVLLYFSSDEGTTWA
GPFETPLTGIVPDKLIELPSRRLIVSAHCSTNGKLAQFMHYSDDGGQTWSGRITVAQSPE
FNLCEVSMLPLGGGVIAAFMRENSSLGYDCKKVISRDDGETWGRIIDFPLPGCHRPTAGM
LNDGKILITYRFHQGGKGWLGSWTQNFFAAITDRASVLAENRNDSSVRILPVDFDRSPKS
DLGYSGWVQFADGEIYIVNYIVDDAPDKAQIRGYSLHMNDFYL

Enzyme Prediction     

No EC number prediction in MGYG000002650_01333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	12	228	4e-23	0.6549707602339181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.25e-22	6	318	4	321	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	3.04e-20	5	250	72	322	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	5.24e-18	47	317	20	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	5.78e-04	161	263	549	660	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam15902	Sortilin-Vps10	0.001	109	222	3	109	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44758.1	8.22e-171	3	343	2	345
ANY72719.1	5.28e-141	1	343	1	342
AYB46154.1	1.37e-138	1	343	1	342
AHF91127.1	5.51e-125	3	343	2	357
AHF89372.1	2.74e-85	3	343	2	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W38_A	1.67e-09	13	222	19	219	Crystalstructure of the pseudaminidase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
3H6J_A	1.67e-09	13	222	19	219	Crystalstructure of a putative neuraminidase from Pseudomonas aeruginosa [Pseudomonas aeruginosa]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002650_01333.