CAZyme Information: MGYG000002650_00807

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452
• CAZyme ID: MGYG000002650_00807
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299	MGYG000002650_51|CGC1	33444.42	10.1168

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002650	3040804	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 1837; End: 2736 Strand: -

Full Sequence      

MNDTSKIWIVAGESSGDLYGAQLARDLRKQNPAVQISGMGGVKMREAGVQLLVDSSELGV
VGIVEVLGSIFKFIRILFFLLKKVEEERPAAVVLIDYPGFNIRLAKRLKQRGIPVIWYIS
PQVWVWRKSNIPRLAEYCTKMMVIFPFEVEVYQGSGLDVEFVGHPLVEIVQARRDASLTR
APGRILLLPGSRRSETKRLLWPMLEAASILKQRNSRLEFVISAPREKVADDIRRDLKEFQ
EKFPKMKLPEIPVVSGQTPQLLQTCIAGFAASGTVTVECAVAGLPLVVAYRLNPVTFLI

Enzyme Prediction     

No EC number prediction in MGYG000002650_00807.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	7	299	8.8e-95	0.8135593220338984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.39e-108	6	299	3	296	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.66e-97	6	299	3	299	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.75e-79	7	299	1	296	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.23e-71	1	299	1	302	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.26e-48	6	299	3	270	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH40861.1	9.45e-111	6	299	7	302
AVM45461.1	1.02e-93	1	299	8	308
QHI67954.1	2.41e-69	9	291	7	287
QEM70104.1	3.70e-68	9	297	2	289
BCG48537.1	1.23e-67	7	297	8	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.99e-39	7	297	9	300	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.99e-39	7	297	9	300	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	1.06e-67	6	297	8	298	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	2.34e-63	2	297	4	298	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	3.55e-62	7	299	6	298	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
A0L8R9	8.03e-62	6	297	6	298	Lipid-A-disaccharide synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) OX=156889 GN=lpxB PE=3 SV=1
Q3JAC1	4.80e-60	2	297	3	297	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002650_00807.