CAZyme Information: MGYG000002640_00258

Basic Information

• Species: Veillonella sp900757715
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella sp900757715
• CAZyme ID: MGYG000002640_00258
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000002640_2|CGC1	39901.71	8.8063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002640	2032895	MAG	China	Asia

• Gene Location: Start: 35250; End: 36311 Strand: -

Full Sequence      

MNTVKASTKQLNILVEIMHGLGDTVCALALLKGVRYLYPDAKLTVLCKMNAGRDIVESSY
IPIDKIIVLDVYKNIYTSFKTIINLRKQNFDIGISAGITPVKKSQLFMKLCGVKQHLGFQ
ASGTNKYDYDIHFVEANVKTIGLDFNDEFRPQLYIDINSDKIIDHYFYGLDKSRPIIGIC
IGNADPSLTNRWLRTGRVFPKAWGITRMRELIKLLVNKDYQVVLIGGNQEEPLLEELHEF
LGLSKVVNLVGKCSIKQSMAAIKRCTCSIGIDTGMQHIAGALSVPTVSIFGPTNPKYIGP
FSRCSYFVEHEVSCKYCYGTDRYIHCKHRRCLTEISPQQVMDIVERVLEKIFI

Enzyme Prediction     

No EC number prediction in MGYG000002640_00258.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	84	325	1.9e-41	0.9155555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	3.15e-42	12	346	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	4.43e-30	12	350	3	332	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	2.82e-18	128	303	59	222	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	3.67e-18	150	349	151	334	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10916	PRK10916	3.96e-11	168	348	174	343	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB1273979.1	1.22e-219	1	350	1	350
SNV52219.1	1.03e-184	1	348	1	348
BBG64103.1	8.46e-61	11	342	1	331
ACV24335.1	1.90e-26	21	344	11	340
AVB77136.1	2.00e-26	21	350	11	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	9.20e-13	151	348	158	343	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
3TOV_A	3.28e-10	168	348	179	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	9.95e-07	142	303	113	292	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	9.95e-07	142	303	113	292	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	1.02e-06	142	303	113	292	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	3.12e-14	174	302	180	299	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37421	1.05e-13	151	350	158	345	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P37692	2.07e-12	151	348	158	343	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P25742	9.78e-10	22	303	5	289	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	5.70e-07	195	303	179	289	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002640_00258.