CAZyme Information: MGYG000002635_00986

Basic Information

• Species: Leptotrichia wadei_A
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Leptotrichiaceae; Leptotrichia; Leptotrichia wadei_A
• CAZyme ID: MGYG000002635_00986
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	MGYG000002635_113|CGC1	39185.55	9.4793

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002635	1818006	MAG	China	Asia

• Gene Location: Start: 1523; End: 2572 Strand: -

Full Sequence      

MEKVVFTTGGTGGHIYPALSIAKKVREKGIDTLFIGTKHRMEKDIVPKENFRFIGLDVLP
LRSIKSVFKMMKATMDTIKLLKKEKPTKIIAFGNYITIPVLVAANVLRIPYYLQEQNHTM
GQANKWFYKGAKKVFVAFENTLESVKEKYKGKFVVTGNPLREEFYGKNKAEERKKLNIKD
DEKVILVIGGSLGAKNINEAILKKWKTLSSDGEIRLFWATGKDNYEASTYRIRDFGTAVV
EPYFENVPELMAASDIVICRAGASTISELIQLEKPSVLIPYDFVGQKENADVLEYVNGAK
IFTNETAEEAIDEALSIVGQASMLEFMSENVRTLKKGNSAEIIVNEMGL

Enzyme Prediction     

No EC number prediction in MGYG000002635_00986.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	185	336	2.9e-36	0.9681528662420382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03785	GT28_MurG	4.48e-113	3	346	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK00726	murG	9.04e-113	1	347	1	351	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	2.45e-97	3	347	2	351	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	5.10e-87	3	345	2	346	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK12446	PRK12446	2.72e-49	1	280	1	279	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBM55882.1	6.03e-247	1	349	1	349
BBM41720.1	6.18e-240	1	349	1	349
BBM43832.1	5.92e-238	1	349	1	349
BBM48653.1	5.92e-238	1	349	1	349
BBM50945.1	8.41e-238	1	349	1	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	2.43e-39	2	345	10	360	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	1.36e-35	3	345	4	349	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	1.87e-34	2	347	7	350	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8R5N5	1.96e-106	1	349	4	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) OX=190304 GN=murG PE=3 SV=1
B7GGI2	2.24e-56	3	347	2	358	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=murG PE=3 SV=1
Q182Y6	7.04e-56	1	347	1	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridioides difficile (strain 630) OX=272563 GN=murG PE=3 SV=1
B8CWJ6	1.64e-54	3	345	2	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=murG PE=3 SV=1
B0K3H0	1.49e-53	3	343	2	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Thermoanaerobacter sp. (strain X514) OX=399726 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002635_00986.