CAZyme Information: MGYG000002628_00303

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-81
• CAZyme ID: MGYG000002628_00303
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		44894.5	4.5104

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002628	2607866	MAG	China	Asia

• Gene Location: Start: 62932; End: 64098 Strand: +

Full Sequence      

MKKIWICAASALILVYTVFPAYGGQWQRNGEFWQYLQEDGTYVSSGWMKDTDGKWYYFDE
NGYMAVNEITPDGYVVGKDGSYIQGMFQDQDQAIEPWDYQQMLGRGMDVDWSKTKDGKNY
YTSKTAADFRQAGIKHVRIRVKDDLDEELLEGLDRQIHDCLSNGLIPVLAYQADEFKNNP
CQETIDGVTAWWRTAAERYQNKSHLLSFDLLIESSDALNRQPEMLNRMIEQCVAAIRETN
PDRIIMMSPRLRSDPAYLSELKIPSAGNGYLMAEWHFYAAGPSRTNEKKLWTVGTEQEKK
RIEDKIKSALDWQMQTGIPTWVGAWMPGNYNDGNDYSLEEQMVFAGFMCDSLEHAGIPFA
VNSDTKFYDREKQEWIEEMIPLRNLIFQ

Enzyme Prediction     

No EC number prediction in MGYG000002628_00303.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	125	361	2.5e-26	0.9427480916030534

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.48e-13	117	345	20	256	Cellulase (glycosyl hydrolase family 5).
COG5263	COG5263	2.01e-09	26	83	257	313	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
NF033838	PspC_subgroup_1	2.07e-07	26	83	628	683	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
COG5263	COG5263	6.05e-07	26	128	175	294	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
NF033930	pneumo_PspA	1.46e-06	26	83	605	660	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB28168.1	7.14e-142	91	387	2	298
QCI58964.2	1.71e-138	89	388	26	325
QMW91197.1	5.76e-134	94	382	29	317
BBK76626.1	5.76e-134	94	382	29	317
QUF84801.1	8.15e-134	94	382	29	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4U5I_A	1.49e-18	92	380	74	374	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5I_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_A Chain A, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
4U3A_A	6.69e-18	92	380	74	374	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U3A_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
5BYW_A	1.98e-15	92	380	74	385	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_C Chain C, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_D Chain D, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_E Chain E, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
4YZP_A	4.67e-09	125	380	59	323	Crystalstructure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis [Bacillus licheniformis],4YZT_A Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis complexed with cellotetraose [Bacillus licheniformis]
2WW5_A	7.25e-08	35	177	171	308	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25472	8.35e-19	93	380	25	324	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1
P16218	8.71e-17	92	380	325	625	Endoglucanase H OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001928	0.996404	0.000843	0.000266	0.000269	0.000270

TMHMM  Annotations     

start	end
5	27