CAZyme Information: MGYG000002623_00157

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Anaerotignaceae; Anaerotignum
• CAZyme ID: MGYG000002623_00157
• CAZy Family: SLH
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1125		119032.4	4.427

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002623	2630993	MAG	China	Asia

• Gene Location: Start: 182866; End: 186243 Strand: +

Full Sequence      

MNKKVGKMTISMALAAALAFAPAQAFAAANDISGHWAEEVIAQWQDKGLISGYEDGSFRP
DNQVTRAEFVIMLNKVLGFTQKGTVSFSDVDADAWYHDAVAVAVEAGYCSGYEDGTFKPG
AIITRAEAAVMIARAKGLAANAEAANRFTDASAIHEWAKGSIGAVTAAGFMSGRPDGTFD
AMNTITRAEAVSSLNRVLMQEEQTTEEKEEKNDVVVTKDDTVIEDQTIEGNLIIDEAVGE
GEVYVNNTTVKGDVVIKGGGDDSIYFDNVTVKGKVKVQKENVRVQVKGDTKFSEIEVKEA
CNIVAKDFEGTVDVISITNEIDSSDKVTIAVPANEVAVNAKASVLVKEDVKELKISKDAA
SSKVEIAKDCTVKTVVADAKVSITGSGKIEKLEANADNITISSSTDVKDTEVAEGVEKPS
TSAGSSGGGGGSSSGGSSVSVADRLLAATKSAIQYNYQDYTYISQLNHQQSGRTAVVTGE
YTKSELLDGSAMNDMARYLGALYRVDNGATVKSIIYNEKEYTWSENLGLHGSNWVQNPEN
SGTTGNTLVSVIVQDFKDKKIQDTIPLTLKGSNGTTITLNCKFTAQTTVTVSTVEEFQKA
LLDENIQTIEIKDTIGDKNTYSVFNVKHPVTIKGGTVYGSFVVTANGTVFDGVKIINKGD
VSGENTAVRNGINAACHTLTVRNCTFAMEQSTNGISNGLSIWPTQEKVDYTITGNTFNGF
NQSDSGYASTAITISGGIQKEFTGIQTKSVLANMTEEQDFAIITGNTFKNCNSDYTREDW
TSENVVYSRAVSNGSNLLLDNAARTAKYYITGAVSRSSDATVKEGTTLTITKNGSLTMGE
GTTFTVNGTLVNNGDLDVYNSKLAGTGKIVVADGGKLNMNANYNGGTGSMLPTIEAIEVQ
NGGTLQSMTTDGGEKATTFVGTSSDARIQTNGATITFGFADSYSDTHPTMEINGNVTIPT
GQTWYTMFDSGTGAIGIKMMLNGTLTVEGTLKVVSANRTGSELVVGSGSRLIVKGTITTA
TKGKVTGTDASSVVTIAENADVKNASAFEANHTYTWKDGVWTKASAESGVFAAKEAIEIA
EPVVEQEMITTEPTTVVEVSAEEAVVIEAEQVNPEEIIVSALTAE

Enzyme Prediction     

No EC number prediction in MGYG000002623_00157.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM54	192	301	1.2e-24	0.9649122807017544
SLH	30	69	8.2e-17	0.9523809523809523
SLH	87	128	1e-15	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033190	inl_like_NEAT_1	1.02e-15	34	189	588	743	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
pfam00395	SLH	3.13e-10	87	128	1	42	S-layer homology domain.
NF033190	inl_like_NEAT_1	2.79e-09	85	198	580	691	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
pfam00395	SLH	7.44e-09	30	69	2	42	S-layer homology domain.
NF033190	inl_like_NEAT_1	2.39e-07	31	135	645	751	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMJ40768.1	2.57e-107	7	420	8	417
BAU26536.1	7.09e-62	3	416	5	438
CCP24966.1	2.59e-59	23	416	31	424
AEE90469.1	2.59e-59	23	416	31	424
ABO50867.1	1.65e-58	18	416	20	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BT4_A	5.99e-09	35	190	33	188	Crystalstructure of the SLH domain of Sap from Bacillus anthracis in complex with a pyruvylated SCWP unit [Bacillus anthracis]
3PYW_A	6.09e-09	35	190	12	167	Thestructure of the SLH domain from B. anthracis surface array protein at 1.8A [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q06852	4.72e-18	45	198	2099	2264	Cell surface glycoprotein 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=olpB PE=3 SV=2
C6CRV0	1.07e-16	36	197	1291	1458	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
Q06853	2.57e-16	50	198	484	638	Cell surface glycoprotein 2 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=Cthe_3079 PE=1 SV=1
P38537	2.91e-16	30	173	37	178	Surface-layer 125 kDa protein OS=Lysinibacillus sphaericus OX=1421 PE=3 SV=1
Q06848	1.30e-13	49	198	242	398	Cellulosome-anchoring protein OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=ancA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000244	0.999001	0.000188	0.000216	0.000186	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002623_00157.