CAZyme Information: MGYG000002621_01352

Basic Information

• Species: Bacteroides ndongoniae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ndongoniae
• CAZyme ID: MGYG000002621_01352
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	MGYG000002621_11|CGC1	39062.89	8.7434

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002621	3633256	MAG	China	Asia

• Gene Location: Start: 7326; End: 8363 Strand: -

Full Sequence      

MDKKIAVVILNWNGCGMLRSYLPSVVSYSEADGATVYVADNGSTDDSVETVHREFPTVRL
ITLDRNYGFADGYNQALKQVEAEYVVLLNSDVEVTEHWLAPLAEYMDAHPEVAGCQPKIR
SLRQKDLFEYAGAAGGYIDKYGYPFCRGRIMGAVEADNGQYDTIAPVFWATGAALFIRLK
DYREAGGLDGRFFAHMEEIDLCWRLRARGRELVCIPQSVVYHLGGATLTKENPRKTFLNF
RNNLLMLYKNLPEGELKNVMRIRTLLDYVAVLNFLLKLQGSNAMAVLRARRAYHALRKDF
AASREENQQKAVLTQIHERIGQSILKAFYLQGKKTFARLMNIRPA

Enzyme Prediction     

No EC number prediction in MGYG000002621_01352.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	120	2.1e-21	0.6941176470588235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	5.43e-47	7	224	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.66e-43	1	311	1	305	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
TIGR03965	mycofact_glyco	1.23e-15	5	222	76	280	mycofactocin system glycosyltransferase. Members of this protein family are putative glycosyltransferases, members of pfam00535 (glycosyl transferase family 2). Members appear mostly in the Actinobacteria, where they appear to be part of a system for converting a precursor peptide (TIGR03969) into a novel redox carrier designated mycofactocin. A radical SAM enzyme, TIGR03962, is a proposed to be a key maturase for mycofactocin.
pfam00535	Glycos_transf_2	3.11e-15	7	110	2	107	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	4.69e-15	7	132	1	128	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA30864.1	6.54e-190	1	339	1	338
QPH58063.1	6.54e-190	1	339	1	338
QUT64828.1	6.54e-190	1	339	1	338
QUT62361.1	6.54e-190	1	339	1	338
QMI79202.1	6.54e-190	1	339	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2FFU_A	9.67e-06	36	263	101	348	CrystalStructure of Human ppGalNAcT-2 complexed with UDP and EA2 [Homo sapiens],2FFV_A Human ppGalNAcT-2 complexed with manganese and UDP [Homo sapiens],2FFV_B Human ppGalNAcT-2 complexed with manganese and UDP [Homo sapiens]
6EGS_A	9.69e-06	36	263	103	350	Crystalstructure of the GalNAc-T2 F104S mutant in complex with UDP-GalNAc [Homo sapiens],6EGS_B Crystal structure of the GalNAc-T2 F104S mutant in complex with UDP-GalNAc [Homo sapiens]
6E7I_A	9.97e-06	36	263	128	375	HumanppGalNAcT2 I253A/L310A Mutant with EA2 and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	9.41e-14	1	222	1	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	9.41e-14	1	222	1	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
Q50864	3.50e-12	4	222	575	792	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P55465	4.15e-08	5	244	627	867	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
A0QSC1	4.07e-07	33	237	106	296	Pre-mycofactocin glycosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=mftF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002621_01352.