CAZyme Information: MGYG000002614_01985

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola
• CAZyme ID: MGYG000002614_01985
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436		50355.67	7.5339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002614	2560607	MAG	China	Asia

• Gene Location: Start: 2178; End: 3488 Strand: -

Full Sequence      

MHRVEKKETIFSICRMYGIEQEDLLALNPELKNGKLKKGKLIFIPYPRSEQKQETAAQPA
TVPTDAELFSQSRGDIKQIKTVKAAIMLPFMADGSGNKEDQNRMVEYYEGFLMAVDSLKQ
LGTNIDLYVYDTKGNHSSIQPILSKPELKNMDIIFGPGYPEHVKPLADFAAKNNVRLVIP
FTSKENEVFNNPMIYQINTPQSYLYSEVYEHFTRKFTNANVIFLTVDPADKSKADFIKGL
KNELRDKHISFQDLGGDITPEVLATVMAQDKDNIFIPTTGRNTALIRLLPQLTVTMRDNP
TYRMLLFGYPEWQTYTHDHLASFFELDTYFYSSFYTNNLFPAAVNFTKSYRKWFSKDMGN
TYPKYGMLGFDMGFYFLKGLARFGSELENNLDKVNVTPIQTGLKFERVNNWGGFINRKVF
FIHFTREFELIKLDFE

Enzyme Prediction     

No EC number prediction in MGYG000002614_01985.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06339	PBP1_YraM_LppC_lipoprotein-like	7.99e-08	83	292	1	221	periplasmic binding component of lipoprotein LppC, an immunodominant antigen. This subgroup includes periplasmic binding component of lipoprotein LppC, an immunodominant antigen, whose molecular function is not characterized. Members of this subgroup are predicted to be involved in transport of lipid compounds, and they are sequence similar to the family of ABC-type hydrophobic amino acid transporters (HAAT).
pfam13458	Peripla_BP_6	2.10e-05	107	385	21	297	Periplasmic binding protein. This family includes a diverse range of periplasmic binding proteins.
cd06268	PBP1_ABC_transporter_LIVBP-like	2.20e-04	110	371	22	281	periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. They are mostly present in archaea and eubacteria, and are primarily involved in scavenging solutes from the environment. ABC-type transporters couple ATP hydrolysis with the uptake and efflux of a wide range of substrates across bacterial membranes, including amino acids, peptides, lipids and sterols, and various drugs. These systems are comprised of transmembrane domains, nucleotide binding domains, and in most bacterial uptake systems, periplasmic binding proteins (PBPs) which transfer the ligand to the extracellular gate of the transmembrane domains. These PBPs bind their substrates selectively and with high affinity. Members of this group include ABC-type Leucine-Isoleucine-Valine-Binding Proteins (LIVBP), which are homologous to the aliphatic amidase transcriptional repressor, AmiC, of Pseudomonas aeruginosa. The uncharacterized periplasmic components of various ABC-type transport systems are included in this group.
cd00118	LysM	2.66e-04	2	29	3	30	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	0.002	2	28	1	27	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR68229.1	3.52e-225	1	436	165	602
QJR60047.1	3.52e-225	1	436	165	602
AII69224.1	3.52e-225	1	436	165	602
QJR72564.1	3.52e-225	1	436	165	602
AND20628.1	3.52e-225	1	436	165	602

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002614_01985.