CAZyme Information: MGYG000002614_01789

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola
• CAZyme ID: MGYG000002614_01789
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		49769.62	7.0822

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002614	2560607	MAG	China	Asia

• Gene Location: Start: 1126; End: 2442 Strand: +

Full Sequence      

MIISASRANTLPSNLQGVWNAAERAAWNGNYQSNINLQEMYWSCGATRLEECEMAYINWI
KGLVPSGRKTAKAYYGTQGWVSNATGDIWGYTCPGSDILWGLYPCGAAWHCRHLWEHYEY
TQDKAYLKEVYPIMKEAAQFWLENLVEKDGYLMVIPSISAEHGIQVDKGAFVPYTTVNGE
SGNKIYTVPAFQDITMVKNLFSDVCKAMKVLGTDEQMYQQIQHTMDRMQPFKIGKYGQLQ
EWIEDVDNPRDHHRHIAHLYGMYPGNLISVQKTPDLAEAVRNSLLLRGYGTFGDRWPHAG
GNWSTIWRTALWSRLGDGNRAIDAFNTMIRNSGYENMGSNQSGYFMVDAIMATSGVFAEM
LVQTIDNNIYLLPALPAEWPEGQIKGIQLRGGYLIDMKWTHGVPDSVTVYVPKGKKNPFV
FWKQKEFSNVHFKTVSLK

Enzyme Prediction     

No EC number prediction in MGYG000002614_01789.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	2	417	2.6e-138	0.5415512465373962

CDD Domains     

MGYG000002614_01789 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI62991.1	1.58e-193	1	420	360	781
QUT74335.1	3.48e-193	1	420	359	780
QDH54741.1	1.82e-98	1	414	343	745
QUT27614.1	9.87e-98	1	414	343	745
QDT00976.1	1.22e-97	1	419	378	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RDY_A	1.88e-88	1	413	339	746	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
4UFC_A	1.31e-84	1	438	339	771	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	4.05e-76	1	414	360	752	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2EAE_A	3.16e-47	1	416	381	845	ChainA, Alpha-fucosidase [Bifidobacterium bifidum]
2EAD_A	4.32e-47	1	416	382	846	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	7.88e-88	1	402	400	795	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	4.84e-65	1	406	356	764	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	4.31e-57	1	426	376	802	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	6.62e-39	1	408	353	704	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999875	0.000185	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002614_01789.