CAZyme Information: MGYG000002606_00889

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000002606_00889
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		39709.63	8.6964

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002606	2480404	MAG	China	Asia

• Gene Location: Start: 11417; End: 12502 Strand: +

Full Sequence      

MKLFVTGTRGFPGIMGGVETHCEQLYTRIAGRGIGVTVARRKPYLTEANRGAHCGDIEFA
DIYAPHDKHFEAIVHTFLAIIRARRSGADILHIHGIGPGLLAPMARLLGLKVVLTVHSFN
YDHDKWNAAAKSVLRLGEWCSIRWANAVIAISGPIRRSLAERYPKKKINLIYNGVNGAQP
TGDRSYLSQIGVGERPYILALGRFTPEKGFHDLVEAYRKSGLSDSCDLVIAGAPDHETDY
SRKLVQDARSAGVILPGFVSGSPLRQLFSGAALSVLPSYNEGLPIAMLEAMSYGLDIIAS
DIEPNRLPMLAPDDFYPLGDTDALAAALRRKTEMPKRRHYDLSPFDWDRVADATLELYKS
L

Enzyme Prediction     

No EC number prediction in MGYG000002606_00889.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	194	333	1.4e-23	0.8875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	7.99e-51	8	359	6	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	4.34e-39	1	361	1	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	3.19e-35	77	356	74	362	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03819	GT4_WavL-like	1.01e-32	14	338	9	325	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
cd03798	GT4_WlbH-like	4.35e-31	8	361	5	376	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12040.1	1.73e-118	1	361	1	361
QCD34526.1	1.86e-117	1	361	1	358
AFL79239.1	1.03e-110	1	359	1	357
BCI64460.1	1.81e-110	1	361	1	361
BBL13096.1	1.79e-108	1	358	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EC1_A	8.01e-06	198	307	325	435	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC1_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC4_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC4_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC6_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC6_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFK_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFK_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFM_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFM_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFN_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFN_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7EC3_A	8.01e-06	198	307	325	435	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC3_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
5N7Z_A	8.50e-06	142	353	131	343	glycosyltransferasein LPS biosynthesis [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],6Y6G_A Chain A, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5N80_A	8.52e-06	142	353	132	344	glycosyltransferaseLPS biosynthesis in complex with UDP [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
6Y6I_A	8.54e-06	142	353	133	345	ChainA, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMZ0	4.64e-13	86	361	77	385	Alpha-maltose-1-phosphate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glgM PE=3 SV=1
P9WMZ1	4.64e-13	86	361	77	385	Alpha-maltose-1-phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glgM PE=1 SV=1
Q65CC7	2.09e-11	82	338	79	353	Alpha-D-kanosaminyltransferase OS=Streptomyces kanamyceticus OX=1967 GN=kanE PE=1 SV=1
Q46638	9.68e-08	198	333	226	370	Amylovoran biosynthesis glycosyltransferase AmsK OS=Erwinia amylovora OX=552 GN=amsK PE=3 SV=2
O32272	2.92e-07	65	302	90	316	Putative teichuronic acid biosynthesis glycosyltransferase TuaC OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002606_00889.