CAZyme Information: MGYG000002599_00559

Basic Information

• Species: Olsenella sp003862195
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella; Olsenella sp003862195
• CAZyme ID: MGYG000002599_00559
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
956		101168.14	5.2154

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002599	2063834	MAG	China	Asia

• Gene Location: Start: 18119; End: 20989 Strand: -

Full Sequence      

MFSKTTGRRAALCLVAAVAACLVVLGGALHAGRAFGVEAVASAGSTSLDVTYSLNRNKAS
SEAASATDASSSDASTSDASASDTSTSNAQADDSATAKARTVALVTDVSTLGTDDATVEE
GGTSFSSITFGGADAAKVQVRYKRGSADWTDWAAGDADQSDATDSVSCVQMKLDSETAEK
YSIVYRVHVADVGWLGWTADGETAGSEKDGAVVDDVEVALVAKENSEALTSFLGSQEAKA
HVEADDSKSDDTKASTSADEKSEGTSSKAKVHTFALTSTTSDAKASVSYRAHVQNIGWQA
SVSDGATAGTTGKSLRVEALSMSLSGMSGGIRYRAHVQNVGWQDWKSDGQTSGTTGRSLR
VEAVQIELTGDVASSYDVYYRTHVQGKGWGAWVKNGATSGTTGQSLRVEAVQVLLVKHGQ
AIPTGDGADYTKRATTTYTSPTILYQSHVQNVGWQTEVSNGTTAGTTGKSLRLEALKIAV
AGVSGGVQYKAHVQNVGWQDWQSDGAIAGTEGSGLRLEAIQVQLTGDVASSYDVYYRVHV
SDIGWMAWAKDGETAGTVGLGRRIEAVQIVLVKKGSAAPSSSDQKVSYPSVETPTVSYAT
SALNGDWQTAVSNGATSGTTGKSLSVERFRAQLSSVSGFGGIKYQVSTDGENWSSAATNG
ADAGTKGTALKAVRLSLTGDAEKYYDVWYRVHVSNVGWLGWTRNGSDAGTNVSSNSIEAV
EVIVKLKGSDAPGSTVRPFAYVDQLNGYDISSHQAGIDVSKVSGDFVFIKATQGTWYKNQ
LSSKGYDYAAWADKAIASGKLVGFYHYAEGGDPIKEADYFYDAIKAYKGRAVVALDWEQT
SNKLFGTGFDVQWCKKFLDRIATLMDARPLIYMSKSVTRKYDWSTVATSYPLWVAQYANN
KTTGYNSNPWTDSYSYGAWASPTIFQYSENGRVDGYSADLDLDLFYGTRSAWISLQ

Enzyme Prediction     

No EC number prediction in MGYG000002599_00559.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	749	935	5.4e-36	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06417	GH25_LysA-like	5.56e-68	745	952	1	195	LysA is a cell wall endolysin produced by Lactobacillus fermentum, which degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. The N-terminal glycosyl hydrolase family 25 (GH25) domain of LysA has sequence similarity with other murein hydrolase catalytic domains while the C-terminal domain has sequence similarity with putative bacterial cell wall-binding SH3b domains. This domain family also includes LysL of Lactococcus lactis.
cd00599	GH25_muramidase	4.40e-35	747	945	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	8.47e-35	746	945	1	184	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	1.54e-30	749	935	2	179	Glycosyl hydrolases family 25.
COG5492	YjdB	1.20e-23	430	724	13	306	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDR66532.1	1.15e-274	101	956	74	928
CBK80688.1	5.25e-65	745	952	3	202
QAS70610.1	9.41e-55	745	955	472	672
ATE84852.1	1.07e-53	745	955	3	203
QIL49850.1	1.40e-53	745	952	3	199

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	6.30e-09	745	955	5	212	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
6ZM8_A	6.65e-07	744	950	1	199	ChainA, muramidase [Sodiomyces alcalophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	6.65e-11	743	945	7	196	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P25310	4.64e-08	728	955	66	289	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P00721	1.15e-06	745	929	2	187	N,O-diacetylmuramidase OS=Chalaropsis sp. OX=36534 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.219549	0.524662	0.244727	0.007454	0.002217	0.001368

TMHMM  Annotations     

start	end
12	34