CAZyme Information: MGYG000002592_02399

Basic Information

• Species: Alistipes sp902388705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp902388705
• CAZyme ID: MGYG000002592_02399
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
251		27736.07	8.1726

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002592	2965227	MAG	China	Asia

• Gene Location: Start: 8; End: 763 Strand: +

Full Sequence      

MADVHGVLRSVTFRTALWLRGIPVAKIEKGREEKKDFIRGGGREMKPLEHTVIRYCDVFR
KLGFVFDDPAPAVRRAHPNPMGEKSGTWVGFAPFSAQQGKTYPEPLAREAVRLLSERHSR
VFIHSGGGAEVEFAREMERVYPNVTALFGRVDMAGEIDLIANLDCVVSMDSLVMHLASLV
ATPVVSVWGATHPGLGFFGYGCNPRGILQADLECRPCSVFGNKPCRFGDYRCLFDVTPAL
IAERVSELVGK

Enzyme Prediction     

No EC number prediction in MGYG000002592_02399.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	13	227	8.1e-30	0.8711111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	4.40e-26	86	247	120	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	2.15e-16	47	230	60	246	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10964	PRK10964	5.35e-05	49	203	138	293	lipopolysaccharide heptosyltransferase RfaC.
PRK10422	PRK10422	0.003	142	191	242	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL09491.1	3.22e-150	1	251	72	322
BBL01632.1	1.52e-148	1	251	72	322
AFL77232.1	1.14e-145	1	251	91	341
BBL07004.1	1.30e-116	1	251	72	322
BBL13855.1	2.08e-100	1	250	84	332

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002592_02399.