CAZyme Information: MGYG000002592_02340

Basic Information

• Species: Alistipes sp902388705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp902388705
• CAZyme ID: MGYG000002592_02340
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338		37493	6.4951

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002592	2965227	MAG	China	Asia

• Gene Location: Start: 23; End: 1039 Strand: +

Full Sequence      

MPGASADGTVHLVDLLYGRGFDVTAIFSPEHGFRGTADAGEHVASSVDTRTGIPIRSLYD
GNTKRPSDEAMRSFDVLLVDMQDVGLRFYTYYISMLRMMDACADYGCRVVVLDRPNPNGS
HVDGPLLDMKYKSGVGALPVPVLHGLTMGEIARMALGEGWAKPCELEVVRCRNYTHDTPY
ELPVAPSPNLPRQRAVYLYPSVCLFEGTVVSLGRGTDKPFECYGHPDMKGYAFAFTPRPT
AGAKHPPLEGKLCRGVDLSGMPLDEAREQGLTLKYVMEAYRNLGLGDKFFTPMFEKLIGA
GYVREMIVAGASEAEIRARWAEDVRRFRALRERYLLYE

Enzyme Prediction     

No EC number prediction in MGYG000002592_02340.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	8	337	1.9e-106	0.9633802816901409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	1.23e-157	10	337	14	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	9.24e-80	11	337	61	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL12464.1	7.38e-222	1	338	68	405
BBL09670.1	7.38e-222	1	338	68	405
AMP51471.1	7.38e-222	1	338	68	405
BBL01800.1	3.00e-221	1	338	68	405
AFL76757.1	3.70e-213	1	337	107	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JJA_A	1.95e-149	8	338	36	369	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]
4K05_A	3.68e-38	10	338	47	399	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	1.21e-66	13	337	74	414	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002592_02340.