CAZyme Information: MGYG000002592_01382

Basic Information

• Species: Alistipes sp902388705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp902388705
• CAZyme ID: MGYG000002592_01382
• CAZy Family: GH110
• CAZyme Description: Alpha-1,3-galactosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573		63948.93	6.4186

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002592	2965227	MAG	China	Asia

• Gene Location: Start: 2573; End: 4294 Strand: +

Full Sequence      

MKRTLRNLCAALLACLTISAAPAAEKVVYLKDFLTPGAAETDAVPAVRAALEHCAATGAR
KLVLPGGRLCMRPEQAVEKYQFISNNDESLKRIAFDLAGMRDFEIDGGGTELLFTGFISP
FSLEECENITIRDLTIDFTRTFNSEGIVEAAGDGWLEIRFPEDYLCDIVNGCLRFRDTEG
TVYPFSNLLEFDAVRREPAFRATDYWLSNRTIPAEKCENGNIRILRKDLKATVGNVMVFG
AAARYNPGFTLADCRGVVIRDVNLYHCGGMGVIAQRSRDIELRKLVIVPSPGKGRMISIT
ADATHYVNCGGYIRMIDCVFENQKDDATNIHGLYMAVERVTGPDKLLLRWRNSGQYGVDF
IVPGMRLELVDNDNVETYAHRSVKSVKRLNKVYTEVTFTEPLPDGVKPLHVVAADDDYPE
VLIKGCRMRGNRARGLLLGSRGRTVIEDNHFHIAGAAILIEGDANYWYEQSGVRDVVIRG
NVFENGNYGSPGWGAACIAVGSGIPNRETSRYHRNIRVEGNTFRVFDPRIINLYCVDGFL
FRRNKIEFTTDYPVVDGQAERFVTRNCDNVVIE

Enzyme Prediction     

No EC number prediction in MGYG000002592_01382.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH110	27	573	5.9e-144	0.9945255474452555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	3.82e-04	420	567	10	132	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
cd14251	PL-6	0.009	472	523	257	311	Polysaccharide Lyase Family 6. Polysaccharide Lyase Family 6 is a family of beta-helical polysaccharide lyases. Members include alginate lyase (EC 4.2.2.3) and chondroitinase B (EC 4.2.2.19). Chondroitinase B is an enzyme that only cleaves the beta-(1,4)-linkage of dermatan sulfate (DS), leading to 4,5-unsaturated dermatan sulfate disaccharides as the product. DS is a highly sulfated, unbranched polysaccharide belonging to a family of glycosaminoglycans (GAGs) composed of alternating hexosamine (gluco- or galactosamine) and uronic acid (D-glucuronic or L-iduronic acid) moieties. DS contains alternating 1,4-beta-D-galactosamine (GalNac) and 1,3-alpha-L-iduronic acid units. The related chondroitin sulfate (CS) contains alternating GalNac and 1,3-beta-D-glucuronic acid units. Alginate lyases (known as either mannuronate (EC 4.2.2.3) or guluronate lyases (EC 4.2.2.11) catalyze the degradation of alginate, a copolymer of alpha-L-guluronate and its C5 epimer beta-D-mannuronate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL12596.1	0.0	1	573	1	574
BBL09802.1	0.0	1	573	1	574
BBL01922.1	0.0	1	573	1	574
AFL77296.1	1.48e-272	1	572	1	573
QUR44558.1	2.81e-263	12	573	10	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7JW4_A	1.41e-142	25	572	25	592	Crystalstructure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta],7JW4_B Crystal structure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta]
7JWF_A	7.91e-142	25	572	25	592	Crystalstructure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_B Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_C Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_D Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1KD83	8.48e-92	18	553	23	558	Alpha-1,3-galactosidase A OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=glaA PE=3 SV=1
Q5L7M8	3.98e-74	14	573	10	577	Alpha-1,3-galactosidase A OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=glaA PE=3 SV=1
Q89ZX0	7.14e-73	23	572	23	579	Alpha-1,3-galactosidase B OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=glaB PE=3 SV=1
Q64MU6	2.18e-72	14	573	10	577	Alpha-1,3-galactosidase A OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=glaA PE=3 SV=1
B2UNU8	2.76e-62	34	573	226	765	Alpha-1,3-galactosidase B OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=glaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000800	0.987918	0.010527	0.000275	0.000220	0.000216

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002592_01382.