CAZyme Information: MGYG000002592_00477

Basic Information

• Species: Alistipes sp902388705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp902388705
• CAZyme ID: MGYG000002592_00477
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		26132.74	8.8245

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002592	2965227	MAG	China	Asia

• Gene Location: Start: 44627; End: 45322 Strand: +

Full Sequence      

MLKKTVLTFAFLTILTTFYGFNAQFSAPVTDDMLLDNSAGYANSLLRDGDYVISAYDNII
RNISEKEGHDWRLMSAIAYHESRFTPDITSRSGARGLMQIMPSVARQFDVPAERIANPET
NIWLANKLMSKIMSTLRFPAGTSDKDRMSIILASYNSGIGHVNDARRLARLNGENPNSWE
VVARYLQLKADPEYYESEVVKCGRFTGSRQTLAYVNDVIGRYDKYCRIAVR

Enzyme Prediction     

No EC number prediction in MGYG000002592_00477.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	66	225	1.1e-22	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.44e-64	65	227	6	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	2.36e-28	70	197	283	406	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	6.66e-27	50	195	272	423	membrane-bound lytic murein transglycosylase MltF.
cd13401	Slt70-like	8.55e-21	55	179	5	126	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	6.00e-20	60	170	1	107	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL78639.1	3.48e-148	1	231	1	230
CBK65133.1	5.90e-140	1	231	1	230
BBL07161.1	1.50e-120	1	231	1	234
BBL03277.1	3.19e-97	1	231	1	227
BBL15387.1	1.83e-96	1	231	1	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AA4_B	6.42e-19	56	223	252	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	6.42e-19	56	223	252	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA2_B	7.28e-19	56	223	300	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_A	7.28e-19	56	223	300	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_D	7.28e-19	56	223	300	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0VRG6	2.91e-21	42	223	274	448	Membrane-bound lytic murein transglycosylase F OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) OX=393595 GN=mltF PE=3 SV=1
A3QCH2	6.80e-20	70	223	292	438	Membrane-bound lytic murein transglycosylase F OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) OX=323850 GN=mltF PE=3 SV=1
A1U3J1	9.99e-20	56	228	286	451	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
Q0A9W6	1.33e-19	56	195	292	427	Membrane-bound lytic murein transglycosylase F 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=mltF1 PE=3 SV=1
A5UG36	1.76e-19	34	195	255	422	Membrane-bound lytic murein transglycosylase F OS=Haemophilus influenzae (strain PittGG) OX=374931 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.039733	0.877233	0.082104	0.000321	0.000302	0.000302

TMHMM  Annotations     

start	end
5	27