CAZyme Information: MGYG000002589_00242

Basic Information

• Species: CAG-110 sp900540635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900540635
• CAZyme ID: MGYG000002589_00242
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
787	MGYG000002589_2|CGC2	89081.01	6.0304

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002589	2786078	MAG	China	Asia

• Gene Location: Start: 17000; End: 19363 Strand: +

Full Sequence      

MNPQFLRELEDSLYLHRPLPLHREQSLEASFPAKRVLDRQSIWTRDCQSIVPSAEGTATL
QRQSTTLTMTAPLRASVWPGGTESDGDYENFGTAQMVFSFPLRSWEKFNRLRFQVRPHIR
GARVLHLNVSIENQGKIPVPDEYFREGATVFDLENGVWQDCIWEFQSMPRDAVTKLRFYV
FCSGHDLCAGDSLEYVFRDIVLEQVERPEHEHGWEHPAPCIHPSTVGYWPQGRKTAVGTV
KADTFSLVDAETGKAVFSAPVHREKNQRGSFSVLDFSDFTTPGNYYLQAGNQVSCTFAIA
QDLAKESLWKVTNFFFCQRCGFPVPGKHSTCHQDFLANHLGETISFGGGWHDAGDASQQA
AQTGEVVQALFENARACKEDKMLYLRLMEEAQWGLDFILRTRFGDGYRATSAGATRITDN
LMGNFDDVPTRVHNHAYENFLFAGIEAYAAETLRGYDDALSGNALHAAIEDYGFAWEKFR
QTGVDPAHMFEHTYNSGLSQYYAVIVWAASCLFSVSQKACYASDAAQTARKLLLCQETNP
EMPIRGFFYRSESHMRIVHFNHQAREHQFMQALDALCRSQPDHPDKQKWEHAMALYGSYL
KAIAGNTAPYGMLPAGVHRADEYEDAALFPYLHVTCDYRKERKNYREQLAEGTPLGAGLI
LRNFPIWFSFRGNSAVLLSMGKAASIVGRYFADEELLQLGREQLYWMWGKNPFGQSLVYG
AGSRYCRQYAVLSGESVGEIPVGIETRGNEDAPYWPQNNNATFREIWVGSACRWLSLCAD
FMEEPEA

Enzyme Prediction     

No EC number prediction in MGYG000002589_00242.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	306	728	6.3e-33	0.8492822966507177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02850	E_set_Cellulase_N	1.22e-20	221	299	2	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam02927	CelD_N	2.45e-14	226	294	8	83	Cellulase N-terminal ig-like domain.
pfam00759	Glyco_hydro_9	3.48e-05	308	525	3	235	Glycosyl hydrolase family 9.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARW20213.1	8.69e-21	717	783	1	67
AOY84056.1	3.65e-18	226	528	41	383
ABW27815.1	4.46e-18	218	411	15	240
AEJ61964.1	9.21e-18	113	367	108	366
AOX03543.1	1.96e-17	226	530	41	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3H7L_A	9.94e-12	226	751	9	525	ChainA, ENDOGLUCANASE [Vibrio parahaemolyticus],3H7L_B Chain B, ENDOGLUCANASE [Vibrio parahaemolyticus],3H7L_C Chain C, ENDOGLUCANASE [Vibrio parahaemolyticus]
6GDT_A	2.73e-10	226	407	8	211	Crystalstructure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_B Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_C Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_D Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961],6GDT_E Crystal structure of exo-glucosidase/glucosaminidase VC0615 from Vibrio Cholerae [Vibrio cholerae O1 biovar El Tor str. N16961]
5DGQ_A	3.92e-08	226	407	8	210	Crystalstructure of GH9 exo-beta-D-glucosaminidase PBPRA0520 [Photobacterium profundum],5DGQ_B Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520 [Photobacterium profundum],5DGR_A Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520, glucosamine complex [Photobacterium profundum],5DGR_B Crystal structure of GH9 exo-beta-D-glucosaminidase PBPRA0520, glucosamine complex [Photobacterium profundum]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002589_00242.