CAZyme Information: MGYG000002587_02180

Basic Information

• Species: Parabacteroides sp900760525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900760525
• CAZyme ID: MGYG000002587_02180
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1137	MGYG000002587_43|CGC1	128618.96	6.4796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002587	4423098	MAG	China	Asia

• Gene Location: Start: 452; End: 3865 Strand: +

Full Sequence      

MRMVNLCKNKLFGTGLMLFLCLGLQAQNKEMRRVATNDCGVTNTQAFLIKGDDYTLPDSF
KGSKEAKTCNFGGTVIYAFDQMDIQADYRMEVVYLADNRREQRIVADGNEVQGPVVLEKG
KEQRYMIDLPKKAYAYGQLILVFEALKGDNAIVSELNLYSSNPTPLKPFGEERRKELVHT
QAYTVDTTVCAEKVLPIYTVKPHRVAGVYNPVLSLNGTWLFNEKPAARFYEQKQDGRDWK
PIVVPGQWSMQGFKVDSAGFGGYQTTFTLPADWQGKQVKLRFDGVSSESVVYLNGKEAGS
HMGGMTAFELDITKGLKAGENLLALRVRSESLADMLGSLTQYAAHQLGGITRKVTLFAVP
DVHLSDLRIVTDLDESYKDADLKVYVSVTNNSEDVRKDVSVRLSLSGLPVVLSRHISEIA
AGSTWNGWLTGKVASPDKWDNEHPSLYTMKIEVGTSDKVIEQVEKRFGFREIEIEGNRML
VNGKAVKLRGVCRHEMHPLTGRVMNPALERKDVELYRDANCNFIRTSHYPPCEELLEVCD
ELGMFVEVEAPVCWIGHHANENWKVLNYRNPEYYPYVLQANMEMIQFYRNHPSIIFWSMA
NESYWNKEFAQVEVYMEKADPTRPFTFHDQAYGGFNNQGSTAPIANIHYPGPDGYKVAAK
SDRPMTYGEYCHLNVYNRSELVTDPGIRSDWALALAPTWDNMYKTPGVLGGSIWSGIDDI
FQMPDGGAVGYGPWGPIDGWRRPKPEYWDMKKIYSPVCVETKNLSPARELVIDLENRYTY
TNLNELRIDWLYGEEKGTAFVDLEPGEKGRLHIRLAHPEKANELYLSFVDPRGFTTDEYL
IPVGRQMQNELQALPSVSTRLKEKKDRYIVTGKDFTCEVSRSSGQILSVKKGKKEILNGG
PWLMALPLTGGGCYPNHNANTPVFNDLCSGWQVEKVEAVQQGDDVVIKVAGTYKEFSGSY
DLKINAGGELSVTYSFNALEDVNPRQWGLVFEAPASFDKTFWRRDGMWSVYPSDHISRPV
GEASLFYEGLPAKVDPRTEPAWSWSMDYNELGSNDFRSTRRNIWYAGLKDGNSNKITVPS
DGKQHWRSWLEKDKIRFLVADFVTAGNEMFLSSYYAPYRKPLKKGDRIGGRIVVRVE

Enzyme Prediction     

No EC number prediction in MGYG000002587_02180.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	210	1012	6.1e-135	0.9521276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10340	ebgA	7.12e-92	213	903	42	761	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.38e-76	211	889	11	684	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	3.95e-61	214	624	54	484	beta-galactosidase.
PRK10150	PRK10150	2.11e-58	212	627	12	447	beta-D-glucuronidase; Provisional
pfam02836	Glyco_hydro_2_C	2.91e-40	472	757	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50207.1	0.0	1	1137	1	1137
QRO24898.1	0.0	10	1136	5	1123
AQT68269.1	1.36e-290	26	1134	25	1211
BBE16084.1	6.90e-285	192	1136	33	985
AOM75904.1	2.25e-261	29	1137	25	1122

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	2.06e-62	213	897	39	742	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	2.07e-62	213	897	40	743	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3BGA_A	1.70e-55	214	909	50	763	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3DEC_A	1.57e-54	214	1042	46	911	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
6ZJV_A	4.29e-45	211	760	56	610	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A [Arthrobacter sp. 32cB],6ZJW_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A in complex with galactose [Arthrobacter sp. 32cB],6ZJX_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant D207A in complex with saccharose [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	1.13e-61	213	897	40	743	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	1.12e-57	201	1040	49	935	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
T2KPJ7	9.57e-53	214	609	55	437	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P06864	9.98e-48	213	901	42	759	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
Q9K9C6	2.89e-47	214	901	47	770	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.009051	0.800543	0.189274	0.000538	0.000278	0.000274

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002587_02180.