CAZyme Information: MGYG000002587_01065

Basic Information

• Species: Parabacteroides sp900760525
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900760525
• CAZyme ID: MGYG000002587_01065
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
153		17126.29	8.627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002587	4423098	MAG	China	Asia

• Gene Location: Start: 5276; End: 5737 Strand: -

Full Sequence      

MKPAQISFVKECLPAALSAGAAFNLNPLAILAQAAFESGWGTSNLAKECRNYFGLTAYGC
SNAYWHGGKTTVKASSYSLDFRRYDTRENSFLDFARLIRNNYRSAWQVSNDLQAYAKEIA
YSPYISELNGDNRETYRHSIIQIAQTIQAIMAL

Enzyme Prediction     

No EC number prediction in MGYG000002587_01065.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	14	147	8.7e-24	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	1.84e-17	14	102	2	90	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
COG1705	FlgJ	2.71e-16	5	148	43	183	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK12713	flgJ	1.22e-14	6	152	182	331	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12711	flgJ	9.37e-14	8	127	218	344	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	7.45e-13	1	124	158	289	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50705.1	5.63e-103	1	153	1	153
QKH97660.1	3.79e-50	7	150	4	147
QUT19172.1	3.79e-50	7	150	4	147
QUT54392.1	4.03e-50	7	150	4	147
QJE27387.1	2.18e-49	7	150	4	147

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2W_A	1.28e-06	23	127	182	273	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]
3FI7_A	3.58e-06	5	107	30	143	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9X9J3	1.37e-10	7	150	162	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9I4P4	4.31e-06	8	153	242	391	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P59205	8.79e-06	23	127	550	641	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1
P59206	8.87e-06	23	127	594	685	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.838904	0.159930	0.000467	0.000301	0.000173	0.000229

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002587_01065.