CAZyme Information: MGYG000002585_00058

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000002585_00058
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400		45855.47	4.9001

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002585	2701793	MAG	China	Asia

• Gene Location: Start: 71832; End: 73034 Strand: -

Full Sequence      

MMNSKQLLFILLMCAVAMTGCDSQEQTTADDESALMRARQTLDSIYQNYSVPGTCLLREN
YPSDINNYTATYLASEQQRDMPNQYSYLWPYSGTVSAVNALFAATQDATYKSILDNKVLV
GLEEYFDTRRTPEAYASYIQSAPQSDRYYDDNVWLGIDFTDAYLLTHEAKYLQKAELIWK
FIESGTDDKLGGGIYWCEQTKESKNTCSNAPGSVLALKLFKATQDSSYLKKGQQLYEWTK
ATLQDPADQLYFDNIALDGNIGKAKYAYNSGQMMQSTSLLYQLTGQQQYLTDARNIAKSC
YYYFFTSYTPQKGDSFRLIKKGDVWFTAVMLRGYIELYQTDRDRTYLNSFDKSLDMAWKN
ARDEHGLFNTDFTGNTRDSRKWLLTQAAMVEMYARLAAIK

Enzyme Prediction     

EC	3.2.1.101

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	67	383	9.5e-69	0.8519553072625698

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	4.28e-28	87	307	34	258	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	1.40e-12	145	271	88	212	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO71507.1	3.58e-230	2	400	1	399
QUT89047.1	1.02e-229	2	400	1	399
ALJ59939.1	4.16e-229	2	400	1	399
QGT72765.1	1.97e-227	2	400	1	399
BAD50241.1	5.39e-218	2	400	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	1.04e-97	38	396	8	362	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4C1S_A	3.65e-67	88	400	45	371	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	1.98e-64	54	397	137	492	CrystalStructure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
4V1S_A	2.01e-29	135	400	127	391	Structureof the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6SHD_A	1.05e-26	150	299	135	288	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9P6I3	6.85e-06	86	307	54	280	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
P36091	6.93e-06	167	304	140	287	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000049	0.999988	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002585_00058.