CAZyme Information: MGYG000002584_01603

Basic Information

• Species: Akkermansia sp900545155
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp900545155
• CAZyme ID: MGYG000002584_01603
• CAZy Family: PL8
• CAZyme Description: Chondroitinase-AC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728		81940.42	9.1181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002584	3044716	MAG	China	Asia

• Gene Location: Start: 74688; End: 76874 Strand: -

Full Sequence      

MCVPAVLLFFAGEVFAVQEDVFTAIEDRMIEEFQQSPRKGRSAKHDGRLEGILDSLHKDG
SFEGIDYRVTHRTQWSPIRHLGNVFQMCRSYTIPGTKWYRNSSLKTDIEKALQYWYDANP
RCNNWWMNQIAVPQQMGRILLLMDRKGTPVESGLRKKLIARMESAAPSLAPHTGANKVDV
AIHYMYRACLTHDARLMKMATDALFEPLSYTMKEGIQHDNSYMQHGPQLYVGGYGMVMIQ
GIVTNAKALVGTEFALSGEKLGILGRFVRETYLPSIRGGSLSWNLLGRGVTRPGSPSQRG
LPSLLEDLCRMDPAHEREYRQAIDRIRGDRGPEWGVVPASRYYYRADYVRHQRPGYFFDV
RMVSNRTARNEQGVGNGEGFKQYFLSDGATALQISGKEFDGIYPVWDWSAIPGVTCPQME
KIPLAQSWVAMGKNPFVGGVSDGMYSAVAYRYADDYQGIDSEARKAWFMFDREIVCLGSA
IGSRGKAPLRTTVNQCLWEGGASVVEDGRERKISKGNHECGGKSAWVLHGGVGYWFPSGG
NVKVVAREQQGKWHDINTNYSDEIVKKDVFSLWVDHGIQPEAASYAYAIVPGIKNAGDVK
NYPVNNIGILRNDATVQAVYHKELDLLQTVFWEPGELAFKGGVIRIDRPCILMMKRLPRK
GLVFYLADPTQTLDKVTVTLNPASRSKKVLTFRMDGDKAWEKGRTHVYEMDRNRYLSLTS
SASSPYSQ

Enzyme Prediction     

No EC number prediction in MGYG000002584_01603.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	341	593	3e-90	0.9919678714859438

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	3.78e-141	41	669	26	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	2.57e-94	341	593	2	251	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	5.19e-50	43	324	23	318	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	7.23e-19	610	677	1	67	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ58172.1	4.76e-189	59	689	61	691
QUT90810.1	3.81e-188	59	689	61	691
QDO70900.1	6.91e-187	6	686	8	691
QUT74574.1	6.18e-184	1	688	10	688
QIU93971.1	3.73e-183	19	716	38	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	7.89e-159	50	687	29	657	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	1.55e-158	50	687	51	679	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
2WCO_A	1.83e-46	82	661	92	715	Structuresof the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]
2X03_A	2.72e-45	82	661	92	715	TheX-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)],2X03_B The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)]
1RWA_A	1.14e-44	86	680	81	714	Crystalstructure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWC_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWF_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWG_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWH_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	8.47e-158	50	687	51	679	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	4.81e-40	46	671	50	724	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q53591	1.27e-19	45	622	272	928	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q59801	4.33e-19	124	623	182	721	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
C5G6D7	4.82e-13	304	673	583	935	Chondroitin sulfate ABC exolyase OS=Bacteroides thetaiotaomicron OX=818 GN=chonabc PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.192559	0.806169	0.000326	0.000348	0.000288	0.000290

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002584_01603.