CAZyme Information: MGYG000002584_01602

Basic Information

• Species: Akkermansia sp900545155
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp900545155
• CAZyme ID: MGYG000002584_01602
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647		74331.06	5.6017

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002584	3044716	MAG	China	Asia

• Gene Location: Start: 72790; End: 74733 Strand: +

Full Sequence      

MLSHLSIFPVLSFGFLLTLSAWNGHAGDDKTLSYPDILDISHTPRGDHGGTGWFTDHGSW
MGFTLPEESGFLNGFCGPYDIDNKFWISPSLVQIGYGEQGVFAPLKRIYYPGHLYMKSYD
GKTTLTQKLRFVDRNNAVLSCSSTNPLSWQFSGKATFKGIRSEQKGNQLIFFLPHGECAA
VTFGRDDIPALQPDGSYSTTRTQGKDTRENTIVISFFNDKDDMERGLARAASIRDNPVPE
LDREEKRWNDYISGILRPGRPELYDRIAVKSMVTLVSNWRSAKGALKHDGMCPSHATGNF
AGGFWAWDTWQQAVATARFDPELAKSQVRSMFDYQDEHGMIADCIFSNPARNNYRDTKPP
LAAWAVYEIWQQDGDKSFLEEMYPKLLRYHQWWYKFRDNDKNGICEFGSTDGSEIAARWE
SGMDNAVRYDHISMVKNADKAWSMDQESVDLNSYLAQEYRILEKITGLLCRDFQEPERTA
NVHQYFFDKEHGYFFDKKLKSGDFVKVEGCEGWTPLWTEIALPEQAERVHELISKPTKFS
TYIPFPTLAFDHPDYEPNGYWRGPIWLNQVYFGISGLRKYGYIREADHYTDQVFTRLQGL
TGNAPIHENYNSQTGERLKAQHFSWSSADLLFLYWEYGEDAEDVKER

Enzyme Prediction     

No EC number prediction in MGYG000002584_01602.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	198	637	8.9e-108	0.5561403508771929

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.04e-120	30	634	28	780	alpha-glucosidase; Provisional
COG3408	GDB1	6.72e-13	305	634	285	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam03200	Glyco_hydro_63	1.03e-07	377	631	186	490	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PLN02567	PLN02567	1.56e-05	321	638	171	545	alpha,alpha-trehalase
pfam01204	Trehalase	1.68e-05	449	588	305	450	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59646.1	9.72e-219	29	639	30	642
QUT89313.1	3.92e-218	29	639	30	642
AVM53117.1	6.58e-217	17	640	18	643
QQY39153.1	9.64e-217	30	639	33	644
ABR39053.1	9.64e-217	30	639	33	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	2.32e-73	33	634	4	753	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.18e-72	33	634	4	753	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.64e-72	33	634	4	753	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	4.22e-70	33	634	5	754	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	5.21e-38	33	422	330	779	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	7.01e-73	19	634	15	776	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	4.41e-22	305	631	98	482	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	1.05e-21	305	631	98	482	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
Q04336	1.02e-08	304	408	478	584	Uncharacterized protein YMR196W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR196W PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001331	0.956518	0.041236	0.000340	0.000297	0.000263

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002584_01602.