CAZyme Information: MGYG000002584_01112

Basic Information

• Species: Akkermansia sp900545155
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp900545155
• CAZyme ID: MGYG000002584_01112
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000002584_7|CGC2	38129.43	6.7147

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002584	3044716	MAG	China	Asia

• Gene Location: Start: 139574; End: 140599 Strand: +

Full Sequence      

MMQECKPDAVVISTDWASHVPIACNCMKRGAHTFEEVPFSPSVAELWQLIDTSEATQKHC
MMMENVNYGREELLFLNIVRQGLIGELLHGEAAYIHNLRDQLLQTDRGEGSWRTAYMELT
NGNLYPTHGLGPVAQYMNLSRGEDTFSHLVSLSSPARGRAEFARKKLSPNHKWNAGKFIC
GDMNSTIVQTGLGRTILIQWDETTPRPYSRLNLIQGTAGTLAGFPTRVAGEKLGSGNYHE
WIQGKDMDAIYEQYEHPLWKRVGDLAQKMGGHGGMDFVMMFRIIECLRQGAPMDQNVYEG
AFWSAVGPLSAQSVENGGMPVRFPDFTRNGWKTTKPLGIIS

Enzyme Prediction     

EC	3.2.1.49

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	333	2.5e-132	0.8195488721804511

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.28e-07	6	96	67	157	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.14e-05	1	65	57	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP71780.1	5.68e-187	1	341	133	473
QWO90201.1	5.68e-187	1	341	133	473
QWO94445.1	5.68e-187	1	341	133	473
QWO87185.1	5.68e-187	1	341	133	473
QWO97007.1	5.68e-187	1	341	133	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	3.39e-183	1	341	108	448	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.98e-53	1	335	86	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2UQL7	3.35e-182	1	341	133	473	Glycosyl hydrolase family 109 protein 2 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0920 PE=1 SV=1
B2UL75	5.12e-181	1	340	140	480	Glycosyl hydrolase family 109 protein 1 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0017 PE=3 SV=1
A1S4U5	1.20e-141	8	340	125	454	Glycosyl hydrolase family 109 protein OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=Sama_1194 PE=3 SV=1
Q0HTG8	5.01e-141	8	340	126	455	Glycosyl hydrolase family 109 protein 2 OS=Shewanella sp. (strain MR-7) OX=60481 GN=Shewmr7_2602 PE=3 SV=1
A0KYQ9	1.43e-140	8	340	126	455	Glycosyl hydrolase family 109 protein 2 OS=Shewanella sp. (strain ANA-3) OX=94122 GN=Shewana3_2701 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002584_01112.