CAZyme Information: MGYG000002584_00830

Basic Information

• Species: Akkermansia sp900545155
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp900545155
• CAZyme ID: MGYG000002584_00830
• CAZy Family: CBM32
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1003		112519.61	6.7893

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002584	3044716	MAG	China	Asia

• Gene Location: Start: 109068; End: 112079 Strand: -

Full Sequence      

MIQQLVMQFSLSHIALCMTALCVSQAFAAPVDATQTETLDFGWKFARFGKMPDGTVKQEP
GKSASMLIADSEESGNPASNAMDGDRSTRWCAADNKSGHNLTIDMGRAVSPQEVKIIWEK
QAKHLFTLEGSTDGRSWKKLAEVSSGDNQTQEDSAKISGTYRYYKLTVKGNGGANWASVR
EISLLDEKDQPLLPKVSGNNADKDHPKSISFNDSQWRSLNLPHDWGIEGPFRMELENETG
KLPWVGIGWYRKTLDIPAKTSGNRFYLDFDGVMSRPKIYVNGELAGEWKYGYSSFRVDIT
PYIRVGQRNTIAVRVDNPPHSSRWYPGGGIYRHVWLNISNPVHIDQWGVFVKTPEVRKEL
AQVDVETSVVNQTDAVVTPVVKEEILQGSDVVASQETEGAPISPGKKGSVATRLEVKNPA
LWTMKSPHMYTIRTTVMVDGKQVDERTTDFGIRTVEWKPDGFYLNGDKIKLKGVCQHGDL
GPLGTAVHKAGYERQVRILKEMGVNSIRTSHNPPAPELLEACDRNGVVVIDELFDMWHEP
KKGQDYHNYFDEWHERDLINFVHRDRNHPSVVLWSSGNEISEQHTADGPKYSQMLTDLFH
REDPTRLVTAGCNVEAAARNGFGDTVDVYGFNYKPWAYNKFSKDRPNQPVYGSETASCVS
TRGEYFFPVPENWDKNKGFYNFQVSSYDLFAPGWAYRPDVEFAAQEDSPTSAGEYVWTGF
DYLGEPTPYNLDQTNAANFTDEKEREAYMKLLKEMGNKAPSRSSYFGIVDLCGFPKDRFY
IYQAHWRPELPVAHILPHWNWPERKGLVTPVHVYTSGDEAELFLNGKSLGVRKKGKGEKD
RYRLVWNDVVYQPGELKVVARKDGKEWAQETVRTTGEPASIRVRPETDSIVGDGRDLAYI
TISLRDKNGLIVPTANNELAVKVTGAADIAGICNGDPTDFTVMSNPNNSSIMKIKAFHGL
AQVILRSKRGQSGKAILQVISKGLKPSQTEVIVREATPEQLKK

Enzyme Prediction     

EC	3.2.1.23	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	192	856	1.2e-122	0.6555851063829787
CBM32	71	182	5.6e-21	0.8951612903225806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.21e-68	180	793	3	633	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.57e-51	245	609	64	446	beta-D-glucuronidase; Provisional
PRK10340	ebgA	4.28e-40	214	608	69	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam18565	Glyco_hydro2_C5	1.01e-30	881	990	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK09525	lacZ	6.58e-30	214	608	80	485	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP63714.1	0.0	10	994	4	987
QWP73627.1	0.0	10	994	4	987
QWP03308.1	0.0	10	994	4	987
QWP61182.1	0.0	10	994	4	987
QWP27099.1	0.0	10	994	4	987

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	9.15e-237	173	993	18	820	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	2.94e-177	195	991	21	805	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	3.50e-173	171	1001	5	808	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4CU6_A	1.31e-151	214	991	41	842	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
4CUC_A	3.62e-151	214	991	41	842	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	2.87e-190	211	995	66	850	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.50e-122	203	967	60	795	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	1.06e-64	208	955	71	799	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	5.34e-62	203	985	39	787	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P77989	1.27e-61	209	931	25	695	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000297	0.998909	0.000241	0.000201	0.000171	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002584_00830.