CAZyme Information: MGYG000002575_00376

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000002575_00376
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	MGYG000002575_18|CGC1	44372.95	8.6915

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002575	2444047	MAG	China	Asia

• Gene Location: Start: 7009; End: 8187 Strand: +

Full Sequence      

MMKKQIVLAALVAMGIQVQDVAARMVPSVPVTGLSVAQAAAGQLPSKAEVKATMKRVADW
QIKDYDAGHRYYDVNWTNGALFVGMIDWAELAEQLDGDDSYYKWLYKIGARNGWHPDKKM
YHADDVAVCQTYLDLYRKYKKPEIMAPTVARLDYVIAHPSAEGFDYTHGKPKTMERWSWC
DALFMAPPVYAKLYRITGDKRYIRFMNKEFRATYDHLFDKEENLFYRDHNYMPPKYEANG
KKIFWGRGNGWVIAGLANILKELPATDKNRKFYETLYVKMAKRLAQVQSADGYWHASLLN
PEAYPSPESSATGFITYGLAYGLNAGLLDKATYLPVVARGWQALLDATDPDGRLGFVQPI
GEDPKKVTREMSVVYGPGAMLAAGCEIYRLAE

Enzyme Prediction     

No EC number prediction in MGYG000002575_00376.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	72	389	4.1e-84	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.41e-98	53	390	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.37e-54	76	358	36	314	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM65072.1	8.73e-178	47	392	28	372
QUU06865.1	8.73e-178	47	392	28	372
QRP56352.1	8.73e-178	47	392	28	372
QQT78403.1	8.73e-178	47	392	28	372
QIU93494.1	7.13e-177	3	392	6	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	2.22e-75	50	390	29	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	2.68e-62	43	392	26	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.84e-54	60	392	39	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	5.85e-13	120	387	81	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.39e-12	120	387	71	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	1.49e-74	50	390	36	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.65e-73	49	392	33	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	5.00e-72	50	387	53	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	3.20e-12	120	387	81	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000307	0.999026	0.000171	0.000169	0.000156	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002575_00376.