CAZyme Information: MGYG000002575_00293

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae
• CAZyme ID: MGYG000002575_00293
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1104	MGYG000002575_13|CGC1	124607.55	4.7169

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002575	2444047	MAG	China	Asia

• Gene Location: Start: 12095; End: 15409 Strand: +

Full Sequence      

MNYSKLFIAAALSAWCGTSMQSGTSRTPMPMITAESNASATDITLTDQGDYQTESYENKH
VRVEGKTNLFLTGNQPLSSSTIDLNGDEAWLYFTQIKPSKVKTDWLQYVTINGKPFDAEN
DRIAIYGSGTVIIPSGMQTAQEALTVYTGKNFTGDSQSYEINTYHNQLGKFDNRIQSFKL
KKGFAATLANNPDGTGFSRMFIASDEDVEFPEMPEGMEGFVSFIRVFKWEWTGKKGWAGG
PSDQVNVSVFYDWDAGGDTENIDREYVPMRHNLGWQSFEVINSRNNVSHLLGYNEPDRSD
QANMSVAHAIEQWPEMFKSGLRLGSPAPSSTPKAWLTDFMAICDSLNYRVDFVVTHAYQH
QATSWWDWNIGATSRTANGRPVWITEWNNGANWTGESWPDASGPQRDANMNIIYDENGEE
TIVNKPLSPDNAEHSKQKIEQILPFFDSYDLLEHHFLYNWVQDARSMILNDELTPAGKVF
ADFKSEIGFKKANEYIHKWKIAPPWIVTSISEDYKNIILRWYDHNGETGKNYILQRKIGD
GEFKNLKIFTVNSDYQYADTLEYTDPIENEQVTYRVYAVSYKDTRSLYSRCITIAKDPIA
APPTLTGEAISATILHLKWETSPNARSYRIERSTSPDGKYETVADYCTATEFVDKGLADG
TSYYYRIYSLNTRGTSVASAPLEIKTKELTVPNAMTGLRAASGDKNVTLTWDFVYDALYD
IYRSESPNGEYIRIASDIEVEENNARYRDEYEMAYDQTYYYKVIAHNREGEAPESEIVKA
SPKAGQCLHLTFNEGDGPIVFDEWGGFHAQMQNNPTWNTITEGDSTKSVVYLNKNDKSYL
QLPKGVVSELTDQYTISSWIYLPEDQGNNTRMFDFGQGTGRYMVFIPQASTGQSRFKLTY
PTDEGTKTFDVTFNFGMELGKWNHVAYTVGQHPQGGLMYMFYLNGKMVSFARDEEYAVPA
GMGETENNYLGRSQWSSDPYCSHGYKDFRIYNQTLSAADIQKLYEGEEPILSHIGTVESI
PNETRLTLTPNPAIAGETVDLKVANTLETPKQIKLGIYDLTGNQIASRTLNEYNATFTAP
ATSGIYIVKVTGNGFTQSCKLIVK

Enzyme Prediction     

No EC number prediction in MGYG000002575_00293.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	244	479	2.7e-34	0.9642857142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam11790	Glyco_hydro_cc	5.25e-21	232	480	6	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.
pfam13385	Laminin_G_3	2.97e-17	838	1001	5	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
COG3401	FN3	1.32e-09	532	780	101	341	Fibronectin type 3 domain [General function prediction only].
TIGR04183	Por_Secre_tail	3.18e-09	1028	1104	1	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
cd00063	FN3	9.97e-09	601	686	3	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUC19783.1	0.0	50	1104	365	1414
APZ45921.1	0.0	50	1104	365	1414
AXY72824.1	1.49e-251	55	1078	395	1386
AEV99551.1	4.06e-235	58	1008	419	1341
QGK74225.1	1.18e-142	54	797	555	1297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAQ_A	3.18e-16	245	387	43	194	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	7.84e-16	245	387	43	194	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	1.93e-15	245	385	43	192	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]
6UAT_A	1.93e-15	245	387	43	194	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei],6UAU_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose and laminaribiose [Amycolatopsis mediterranei]
3MPC_A	5.05e-10	599	680	2	87	ChainA, Fn3-like protein [Acetivibrio thermocellus ATCC 27405],3MPC_B Chain B, Fn3-like protein [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q09788	2.14e-06	232	407	294	473	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000216	0.021032	0.978735	0.000009	0.000013	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002575_00293.