CAZyme Information: MGYG000002574_03436

Basic Information

• Species: Fusobacterium_A ulcerans_A
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A ulcerans_A
• CAZyme ID: MGYG000002574_03436
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		40711.58	6.7743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002574	3729499	MAG	China	Asia

• Gene Location: Start: 726; End: 1802 Strand: +

Full Sequence      

MKLQIINIPTMKKLVNNLVFAIIAATLFYACSAKPSYSDKVTPLKKALANKFLIGTALNS
KQITGKDSTGMHVITEHFNAIVAENCMKCEEIHPEENRYDFTLSDAFVDFGTSLDMAITG
HTLIWHSQLPKWFCHDEKGNLVSAEILKKRMKEHIHTVVGRYKGRIVGWDVVNEAINDDG
TWRNSPFYQILGEDFIYLAFQYAHEADPDAQLYYNDYNEWHPGKRKTIIKMIKSLKERGL
RIDAIGMQGHIGMDYPSIEEYQAAINDYVSAGVKVMVTELDLSALPSVRHNVGANVSDVE
TYRKEVNPYIEGLPAKISKEWNARMSDFFDLFLQNSDKILRVTLWGVADGDSWKNGYK

Enzyme Prediction     

No EC number prediction in MGYG000002574_03436.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	44	356	1.3e-99	0.9108910891089109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	2.63e-117	44	356	1	284	Glycosyl hydrolase family 10.
smart00633	Glyco_10	6.30e-108	87	357	1	244	Glycosyl hydrolase family 10.
COG3693	XynA	1.88e-88	22	356	5	311	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRX63295.1	8.46e-163	11	357	1	343
CBH32823.1	9.98e-153	11	357	1	346
QUT30262.1	9.98e-153	11	357	1	346
QUR44063.1	9.98e-153	11	357	1	346
QRN00779.1	9.98e-153	11	357	1	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PMU_A	1.43e-95	42	357	1	324	Crystalstructure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_B Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_C Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_D Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_E Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306],4PMU_F Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P1211) [Xanthomonas citri pv. citri str. 306]
4PMV_A	1.47e-95	42	357	2	325	Crystalstructure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P43212) [Xanthomonas citri pv. citri str. 306],4PMV_B Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (XynA) belonging to GH10 family (space group P43212) [Xanthomonas citri pv. citri str. 306]
1UQY_A	7.30e-93	42	357	25	340	XylanaseXyn10B mutant (E262S) from Cellvibrio mixtus in complex with xylopentaose [Cellvibrio mixtus],1UQZ_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with 4-O-methyl glucuronic acid [Cellvibrio mixtus],1UR1_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with arabinofuranose alpha-1,3 linked to xylobiose [Cellvibrio mixtus],1UR2_A Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with arabinofuranose alpha 1,3 linked to xylotriose [Cellvibrio mixtus]
2CNC_A	2.64e-92	42	357	34	349	Family10 xylanase [Cellvibrio mixtus]
6FHE_A	1.63e-87	37	357	6	313	Highlyactive enzymes by automated modular backbone assembly and sequence design [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49942	3.61e-146	26	357	12	343	Endo-1,4-beta-xylanase A OS=Bacteroides ovatus OX=28116 GN=xylI PE=2 SV=1
P48789	3.87e-114	44	357	26	339	Endo-1,4-beta-xylanase A OS=Prevotella ruminicola OX=839 GN=xynA PE=3 SV=1
O69231	2.12e-80	38	357	2	303	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P45703	1.43e-77	31	353	2	298	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
Q60037	4.64e-69	40	354	366	665	Endo-1,4-beta-xylanase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000732	0.161187	0.837704	0.000107	0.000145	0.000112

TMHMM  Annotations     

start	end
13	30