CAZyme Information: MGYG000002573_01074

Basic Information

• Species: Ruminococcus_C sp900545285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp900545285
• CAZyme ID: MGYG000002573_01074
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	MGYG000002573_24|CGC1	54817.82	4.3046

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002573	2234911	MAG	China	Asia

• Gene Location: Start: 8538; End: 10055 Strand: +

Full Sequence      

MDTHAAALLHQKTDTLGGIGLKLHTILLSLAVVCGALCIGGFSAAAADAGDTPLLATGST
PLTQVRATGTPATWEKTIGGEWQYFDEDGNAVSGETTIDGKVYLFAPDGVLRTGWQTVDG
ARFYYNAETHERQWGWIHIGDQIYYADRWDGKYTGRQVGLVDLDGNDSGKDAVYLLDSHG
ALQTGYFTYEDGARYYADASGVIVTGDVQIGDTWYQFGDDGKQVTGWVTIQGGRYYFDSD
TGMCRQGLCTIDNSIYYITNTGVQTGMQTAGDETYYFNAEGAMETGLQTIGDNLYFFQED
GTLFRDDSITIDGTEYTADADGVLTKKILTPETDAAGRTYVMGQARATVEQMQAYIRSVN
PNVAQSVLDMIPYYLSEGEAEGVRGDIAFAQACLETGNFAFRGSAVTLDQNNFCGLGVTQ
NGMKGNSFATPQLGIRAQIQHLKAYADTAPLNQAQIDPRFSYVIRGCAPYVDWLGIQENP
QHRGWAAGKNYGSAILRILAAILKQ

Enzyme Prediction     

No EC number prediction in MGYG000002573_01074.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	370	500	1.1e-16	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5263	COG5263	9.07e-23	52	296	58	308	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
NF033930	pneumo_PspA	1.53e-22	70	322	440	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	5.90e-19	112	322	485	680	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
COG5263	COG5263	1.65e-17	113	332	81	302	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
NF033840	PspC_relate_1	3.05e-15	166	313	492	637	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO23193.1	2.01e-74	342	503	1	162
AFC63685.1	1.12e-73	313	502	175	366
QJU16443.1	3.97e-72	341	503	5	167
QMW80001.1	2.65e-71	332	503	166	337
QIB57222.1	2.65e-71	332	503	166	337

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	6.87e-23	340	504	40	197	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.300879	0.624387	0.068523	0.002942	0.001410	0.001859

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002573_01074.