CAZyme Information: MGYG000002572_00680

Basic Information

• Species: CAG-354 sp900555085
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-354; CAG-354 sp900555085
• CAZyme ID: MGYG000002572_00680
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		41288.22	4.7305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002572	1311921	MAG	China	Asia

• Gene Location: Start: 16050; End: 17138 Strand: +

Full Sequence      

MNKKIGICIIIALFIFVVIGVEGLVKSKNETSKLEESQNQVEGEFMKEDNVENIVNEAEN
NSNKTPVEVNGKLSVKGKNIVNKNGEKFVIQGVSTHGIAWFPQYVNEETFKTLRDDFNVN
TIRIAMYSNQNDGYNESLHTKVSEGVEYAKNLGMYVIIDWHILNDNNPNQNKESAKNFFN
EMTEKYKDYNNVIYEICNEPNGSVQWEKDIKPYAKELITTIREKDKDAIIIVGTPTWSQD
VDIVSKSPIEGENNIVYALHFYAATHKQDLRNKLKTALDNNLPVLVSEFGICDASGNGNI
DINEANNWIQYLRENGIGYVCWNLSNKNESSSLLKNTTQKISNWTDEELSEEGKWLKETY
NK

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	83	320	1.4e-90	0.9915611814345991

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.21e-70	81	328	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	5.38e-14	50	328	22	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam13204	DUF4038	6.07e-04	146	265	90	223	Protein of unknown function (DUF4038). A family of putative cellulases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM00780.1	9.79e-124	65	357	213	509
QWT53734.1	1.57e-122	65	357	213	509
CBK83877.1	1.02e-115	52	358	210	525
QBR94633.1	6.57e-115	71	361	92	387
SIP56455.1	2.74e-113	69	356	83	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XZW_A	8.08e-104	64	357	3	299	Endo-glucanasechimera C10 [uncultured bacterium]
3PZT_A	1.81e-103	64	358	28	322	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
6GJF_A	2.33e-103	65	358	5	298	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
4XZB_A	9.55e-103	64	357	3	300	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
1LF1_A	5.41e-90	67	358	6	298	CrystalStructure of Cel5 from Alkalophilic Bacillus sp. [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10475	2.01e-100	64	358	33	327	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P07983	1.60e-99	64	358	33	327	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P23549	2.01e-97	64	358	33	327	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
P22541	3.01e-91	42	356	92	403	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
Q59394	4.16e-89	65	358	33	326	Endoglucanase N OS=Pectobacterium atrosepticum OX=29471 GN=celN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.676630	0.313551	0.007207	0.000885	0.000469	0.001247

TMHMM  Annotations     

start	end
5	24